KEGG   Pichia pastoris: PAS_chr4_0737Help
Entry
PAS_chr4_0737     CDS       T01092                                 

Definition
Mitochondrial NADH-cytochrome b5 reductase, involved in ergosterol biosynthesis
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ppa  Pichia pastoris
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppa00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1408096..1409004)
Genome map
AA seq 302 aa AA seqDB search
MLKNPNMFAKISSSRFFIPTVAATAAAIGSTYFLSTRNFASNESPKAFVGDDKWIDLQLI
KAEDLTHDTKKVYFKLPEKDQVSGLEVASLLLAKFVTPKGSNVIRPYTPVSDVNEKGVVE
FVIKRYETGKMGNHIFNLKPNDTLAFKGPLQKWKWQPNQFKEIALIGGGSGITPLYQLIH
HITNNPEDKTKVKLFYGNKTPNDILLRKELEETAAKNPEQFELHLFLDKDAEQVPSASSG
FISKDVLKKYLPGPSNDSHVFVCGPPPLYKAISGEKVSPQDQGEVTGALADLGYDKTHVF
KF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagaatcccaatatgtttgctaaaatttcatcatcccgtttctttatcccaact
gttgctgccactgccgctgcaattggctcgacctactttctatccaccaggaactttgcc
tcgaacgagtccccaaaggctttcgttggagatgataaatggattgaccttcaattgatc
aaagctgaggatctcactcacgacacaaagaaagtgtatttcaagcttccagaaaaggac
caagttagtggcttggaggtcgcttccctgttgttggccaagtttgtaaccccaaagggc
tctaacgttattagaccatacacccctgtctctgacgtcaatgagaagggagttgttgag
tttgtcatcaagagatatgaaactggtaaaatgggtaatcacattttcaacctgaaaccc
aacgacactcttgccttcaagggtcctctacaaaagtggaaatggcaaccaaatcagttc
aaggaaatagccttgattggtggtggttccggtattacccctctgtatcaattgattcat
catattaccaacaaccctgaggacaagaccaaggtcaagttgttctatggtaacaagact
ccaaatgatatccttttgagaaaggagttggaggagactgccgccaagaaccccgagcaa
tttgaactacatcttttcttggacaaggatgctgagcaggttccaagcgcctcttccggt
ttcatttccaaggacgttttgaagaagtacttgccaggtccaagtaatgacagtcacgtc
tttgtgtgtggtccacctcctttgtataaggccatctctggtgagaaagtttctcctcag
gaccagggtgaggttaccggtgctcttgccgatttaggatatgacaagactcatgtgttc
aagttttag

DBGET integrated database retrieval system