KEGG   Pichia pastoris: PAS_chr4_0777Help
Entry
PAS_chr4_0777     CDS       T01092                                 

Definition
Protein O-mannosyltransferase, transfers mannose from dolichyl phosphate-D-mannose
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ppa  Pichia pastoris
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ppa00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1473751..1476009
Genome map
AA seq 752 aa AA seqDB search
MATEEERNELRSRMDANNSKVSTFTTNNSDDPSVDSQGKVKIKSWVWSLESLIGPLVITA
LAIFLRVYQIGKADRVVWDEAHFGKFGSFYLKHQFYFDVHPPLGKLLTGLAGHIAGYNGS
FEFKSGVTYPEYLDFKVMRIFNAVFSALCAPVAYWTAKSCGYSLLTVYLISLMVVFENSY
VVLGKFILLDSMLLFFTTTTFLGLSKVHSLRQQGKELTYPWCFWLTFTGLSIGCVCSVKL
VGLFVTALVGLYTILDLAVKRYDENLKWSKYLTHWAVRILTLIILPFAIYMLSFKIHFAV
LYKNGDGASSMSTLFQSNLEGTKILIDAPRDVAYGSELTIRSQGLSQNLLHSHGSIYPEG
SNQQQVTTYGHRDNNNQWIVHYPVLSKKQVKENDNSTVPEMMKDGDTIRLRHQHTGANLH
SHRIQAHVSKQYYEVSCYGNAKVSDGNDEWVVEVAEQIHSDDPKYAAANESDLKFQELLH
PISTSFRLRHKRIGCYLATTGMAYPSWGFKQGEVVCRPSWTSRDKSTWWNIEDHKNKKLP
NATSYKAPKSYFWRDFVMLNYAMLASNNALVPDPDKFDKLASQWWQWPIINVGLRMCGWS
ASQSRYFLMSSPFNTWLSTASLAVFCLIVLILVLQWQRQRLNLSSRQYWELVIKGFVPFF
GWALHFAPFIVMQRVTYVHHYVPALYFAMFLLGFTVDYLTAKRNCYIKTLIYFVFYAGTI
YSFYYFSPLSFGMDGPLKNYAYLQWFKSWTMV
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagaggaagagagaaatgaactgagaagtcggatggacgccaataattcaaaa
gtttccacgttcactacgaacaattcagatgatccttctgttgatagccagggtaaggtg
aaaattaagtcatgggtttggagccttgaatctttaattggccctctggtgatcactgcc
ttggcaatttttcttcgagtttaccaaataggaaaagctgatagggttgtttgggatgaa
gctcatttcggaaagtttgggtcattctacttgaagcaccagttctattttgatgtccat
cctcccctgggaaaacttcttacaggtttggctgggcacatagctggctataatgggtcg
tttgagttcaagagtggggtgacgtatccagaatatctcgatttcaaggtaatgaggata
ttcaatgctgttttcagtgcactttgtgcccctgtggcatattggactgccaaatcatgt
ggatattctctactcacggtttaccttatatcattgatggtagtttttgaaaactcctac
gttgttttggggaagtttattctgttggattccatgcttttgtttttcaccacaacaacc
tttctgggtttatcaaaagttcattcattgagacagcaaggaaaagaattaacttacccg
tggtgcttctggttgacctttacaggtttatctattggatgtgtatgcagtgtcaaactt
gttggactgttcgtaactgcccttgtgggtctttataccattcttgaccttgccgttaag
agatacgatgaaaaccttaaatggtctaagtacttgactcattgggcagtgcgcattcta
acgttgattattctaccgtttgccatctacatgttatcctttaagatccattttgctgtg
ctttacaagaatggagatggtgcttcttcaatgtcaactctgttccaatccaatttggag
ggaacaaaaattctaattgatgcccctagagatgttgcatatggatctgaacttacaata
agatcccaaggcctttcccaaaatcttttgcactcccatgggtcaatttatcccgaagga
tctaaccaacaacaagttacaacctacggtcatagagacaataataaccaatggattgtt
cattaccccgtcctcagcaagaagcaagttaaagaaaatgataactcaacagttccagag
atgatgaaagatggtgacaccattcgtttaagacatcaacatactggtgcaaacttgcat
tctcacagaattcaagctcatgttagtaaacaatactacgaagtatcatgttacggaaat
gcaaaagtttcagacggaaacgatgagtgggttgtggaagttgcagagcaaattcattcc
gatgaccctaaatatgccgctgccaacgaatcagatttaaaattccaggaactgcttcac
cctatatctacttccttcagacttcgtcataagagaattggatgttacttggccactact
gggatggcatatccaagctggggtttcaagcagggtgaagtagtctgccgaccatcttgg
acctcaagggacaaatctacgtggtggaacatcgaggaccataagaacaaaaagctgcca
aatgctacttcatataaagctccaaaatcttacttctggagagactttgtcatgctgaac
tatgcgatgttagcatccaataacgccttagtgcctgatcctgataaattcgataaactg
gcttctcaatggtggcaatggcctatcattaatgttggactccgaatgtgtggttggagc
gcctcacaatctagatacttcttgatgagtagcccatttaatacttggttgtcaactgct
tctttggctgttttttgcttgattgttcttattttagtcctacaatggcaaagacaaaga
ctcaatctctcttctagacagtactgggagctagtcatcaagggttttgtcccatttttt
ggttgggcgttgcattttgctccattcattgtgatgcaaagggtcacatacgtgcaccat
tatgttcccgctctctactttgccatgttcctgctgggatttactgtagactatttgaca
gccaagaggaactgctacatcaaaacattgatctattttgtcttttatgcgggcactatc
tactctttctactacttttcacctctcagttttggcatggatggccctttaaaaaattat
gcgtacttgcaatggttcaagagttggaccatggtttga

DBGET integrated database retrieval system