KEGG   Pichia pastoris: PAS_chr4_0783Help
Entry
PAS_chr4_0783     CDS       T01092                                 

Definition
Glycerol kinase, converts glycerol to glycerol-3-phosphate
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppa  Pichia pastoris
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PAS_chr4_0783
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PAS_chr4_0783
Exosome [BR:ppa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAS_chr4_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1483780..1485645)
Genome map
AA seq 621 aa AA seqDB search
MGKDYTPLVATIDIGTTSTRAILFDYHGQEVAKHQIEYSTSAQDDIKRKRSQIISSEGIS
LTVSDDLEVESVDNKAGPTLQFPQPGWVECRPSHILANAVQCLAACLVTMENKNLDRDEK
NKYKLISIGVANMRETTVVWSKKTGKPLYNGIVWNDTRNNDIVDEYTAKYSEKEREEMRT
LCGCPISTYFSATKFRWLLKHVPEVKQAYDNADGDLMFGTIDSWLIYHLTNEKSHVTDVT
NASRTNFMNIETNKYDDRLLKFWDVDTSKVILPEIRSSAEVYGHFKVPHLESIGYVESYL
TDDALALLETIEGAPLAGCLGDQSASLVGQLAVRKGDAKCTYGTGAFLLYNTGDQTLISE
HGALTTVGYWFPGLDESEDGKHSSKPQYALEGSIAVAGSVVQWLRDNLRLISKAQDVGPL
ASQVDNSGGVVFVPAFSGLFAPYWDSNSRGTIFGLTQYTSASHIARAALEGVCFQTRAIL
KAMISDAGASADFLEESSKATGHNPLSVLAVDGGMSKSDEMMQIQADILGPCVTVRRSIN
PECTALGAAIAAGFGVPKEDRIWGSLKECTEAILEGNKMYLAAGNTSLDFKATLSDEVRR
KEWRLWENAIAKAKGWLKDTA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagactatacaccactagttgctaccatcgatattggtactacctccaccaga
gctattctttttgactaccacggtcaggaagtggccaagcaccagatcgagtactctacc
tctgctcaggatgatatcaaaagaaagcgttctcagatcatctcttccgaaggtatttcc
ctgacagtttctgacgacttggaagttgagtccgttgacaataaggctggtccaactttg
caatttcctcagccaggctgggttgaatgtcgtccaagtcacatcttggccaacgccgtt
cagtgtcttgctgcttgtttagtcaccatggagaacaagaacttggaccgagatgaaaaa
aataaatacaagctcatatctatcggtgttgccaacatgagagagaccacggttgtttgg
tccaagaagacaggaaagcctctttacaacggtattgtgtggaacgataccagaaacaac
gatattgttgacgagtacaccgccaagtactctgagaaggagagagaggaaatgcgaacc
ttgtgtggttgtccaatctccacctacttttctgcaaccaagttcagatggttactgaag
catgttcctgaggtcaaacaggcctatgacaatgctgatggggatctaatgtttggtact
attgactcttggttgatttaccacttgactaacgaaaaatcccacgtcactgatgttacc
aatgcctccagaaccaacttcatgaacattgaaaccaacaaatatgacgacagacttttg
aaattctgggacgtcgatacttccaaagtcatccttccagaaatcagatcttccgcagaa
gtctacggacacttcaaggtcccacacttggagtctattggatatgttgagtcttacctt
actgatgacgcccttgctcttctggaaactattgaaggtgctcctttggctggatgtctg
ggtgaccaatctgcctctttggttggacagttggctgtcagaaagggtgatgccaaatgt
acatatggtaccggtgctttcttgctgtacaacactggtgatcagactttgatttctgag
cacggtgctttgaccactgtgggatattggttcccaggtttggatgagtccgaagatggc
aaacactcttctaagccacagtatgctttggagggatcgattgctgtcgctggatctgtc
gtgcaatggttaagagataaccttcgtttgatttccaaggctcaggacgtcggaccattg
gcttctcaagttgacaactctggaggtgtggtatttgttccagcattttcaggattgttt
gccccttactgggattccaactccagaggaaccattttcggtctgacccaatacacctca
gcttctcatattgctagagctgctttggaaggtgtctgtttccaaactagagccattttg
aaggccatgatcagcgatgcaggagcttctgctgactttttggaggaatcatccaaggcc
actggccacaaccctctgtcagttcttgccgtggacggaggtatgtccaaatcagacgag
atgatgcagatccaagctgatattttgggtccatgtgtcactgttagacgttccatcaac
cctgaatgtactgcactgggagctgccattgctgccggttttggtgtccctaaggaagat
agaatttggggttccttgaaggaatgtaccgaggccattcttgagggtaacaagatgtac
ttggctgcagggaacacttctttggacttcaaggccacattgagcgacgaggtcagaaga
aaggaatggagattgtgggaaaatgccattgcaaaggcaaagggctggcttaaggacact
gcttaa

DBGET integrated database retrieval system