KEGG   Komagataella pastoris: PAS_chr4_0806Help
Entry
PAS_chr4_0806     CDS       T01092                                 

Definition
NADP-cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ppa  Komagataella pastoris
Brite
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PAS_chr4_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1526379..1528430)
Genome map
AA seq 683 aa AA seqDB search
MDTLDLSVLIAIALALIAYFSKGSLWGKEDDNSVHGVAGGFQTRDLVEILNSTNKKALVL
YGSQTGTSEDYAHKYARELQSKFSIPTLCGDLSEFDFDNLNDIPEQVEGFTFITFFMATY
GEGEPTDNAVEFIEFLKNDAEDLSNLKYTVFGLGNSTYEFYNQMGKTTNKRFSELGAQLV
GTFGEGDDGQATMDEDFLAWKDSLFDTIKKDLHLEEHEVVYQPGLKVKENTALTTSSPNV
SVGEPNKAYVLREDENLLQYGPFDHTHPYIAPISSSRELCSETSERNCIHLEFDLSNTNL
RYSTGDHLAVWPSNANEHVESFLKVFNLTDKRSSVFDIEFLDPTVTVHFPFPTTYEAVVR
HHLEISGPISRQTLKQFIPYAPDQSTKQEVIRLSESKDVFHNEVTAKYYNLADLLFKVSK
ETPWNVPFNFLIETMPNLQHRYYSISSSSLSEKQTIHITAMIEAFTPTGSDHIVTGVTTN
LLWNIQLNQDKSTVKAPVSYDLNGPRNLFSPYKLPVHIRRSTFKLPSNPALPVIMIGPGT
GVAPFRGFIRERCQQVDNGTPNIGQSILYYGCRNSEQDFLYRDEWPTYSKKLGDKFKMYT
AFSRENSHKVYVQHRLLENSREFIELMDQGAFIYVCGDAGKMAKDVNKAIVEILIKEKGL
SEEDATESIREFKTSNRYQEDVW
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggataccttggacctttctgttttgattgctattgccttggctttgatagcttacttt
agcaaaggatctctttggggcaaagaggatgataactccgtccacggagtagctggagga
tttcagaccagagacctggttgagattttgaactctaccaacaagaaggcactcgtcctt
tacggatcacaaacaggtacatctgaggattatgctcataagtacgctcgtgaactgcaa
tccaagttcagcattcccaccctctgtggagacttgtcagagtttgattttgacaatctg
aacgatatcccagagcaggtcgaagggttcactttcatcactttcttcatggctacgtac
ggcgaaggcgagcctactgacaacgccgtagagtttatcgagtttcttaagaacgacgcc
gaggatctgtctaatctgaagtatactgtgtttgggttgggtaactctacttacgagttc
tataatcaaatgggtaagaccactaacaagcgtttctcagaacttggtgctcaattggtt
ggaacctttggcgagggcgatgatggtcaggcaactatggacgaggacttcctagcatgg
aaagattccctgtttgatacaatcaagaaggatttgcatttggaggaacatgaagttgtc
taccagccaggtctaaaagtaaaggagaacacagcgcttacaacatcttctcctaatgtc
tctgttggtgaacctaataaggcttatgttcttcgtgaagatgagaatctgctgcaatac
ggtcccttcgaccacactcatccttacattgcgcccatctccagctccagagaactctgt
tctgaaacttcggagagaaactgtatccatctagaatttgatctcagcaacaccaacttg
cgttattccactggcgatcatttggccgtgtggccaagtaatgctaatgagcatgtcgag
agctttttgaaagtgttcaacctcacagacaaaagatcttctgtgtttgatattgagttc
ctggaccctactgtcacagttcactttccgtttccaaccacatacgaagcagttgttcgt
catcacctggaaatttctggaccaatctctagacagacattgaagcaattcattccttat
gctcccgatcagtctactaaacaggaggtaatccgattatcggagagcaaagatgtgttc
cacaacgaagtcacagcaaaatactataaccttgctgacctcttgttcaaagtctcaaaa
gaaactccatggaatgttccattcaacttcctgatcgagaccatgcctaatctgcagcat
cgttactattctatctcatcatcttcattaagtgaaaagcaaactattcatatcaccgca
atgattgaggccttcacgcctactggaagtgaccatatagtgacaggagtcaccactaat
ttgctatggaacattcagctgaatcaggacaaatctactgttaaggcgcctgtctcctat
gatttgaacggcccaagaaatttgttttctccatataaacttccagttcatatcagaagg
tccactttcaaacttccaagcaacccggccctgccagtgatcatgattggacctggtact
ggggtagctccattcagaggctttatcagagaaagatgccagcaagttgacaatggaact
cctaatattggtcaatctatcctctattatggctgtagaaattctgagcaggatttcctt
taccgtgacgaatggccaacatattcgaagaagttaggagataagttcaagatgtacact
gcgttcagcagagaaaattcacacaaagtttatgttcagcataggttattggaaaactca
agggaatttatcgaactgatggaccaaggtgcttttatctacgtatgtggagatgctggt
aaaatggctaaggatgtaaataaggcgattgttgaaatcctcattaaagagaaaggattg
tcagaggaagatgctacagaaagtattagagagttcaaaacttccaacagatatcaggaa
gacgtttggtaa

DBGET integrated database retrieval system