KEGG   Komagataella pastoris: PAS_chr4_0844Help
Entry
PAS_chr4_0844     CDS       T01092                                 

Definition
Protein disulfide isomerase, multifunctional protein resident in the endoplasmic reticulum lumen
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ppa  Komagataella pastoris
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PAS_chr4_0844
Enzymes [BR:ppa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PAS_chr4_0844
Exosome [BR:ppa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PAS_chr4_0844
  Exosomal proteins of colorectal cancer cells
   PAS_chr4_0844
  Exosomal proteins of bladder cancer cells
   PAS_chr4_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(join(1588618..1589474,1589614..1590172))
Genome map
AA seq 471 aa AA seqDB search
MQFNWNIKTVASILSALTLAQASDQEAIAPEDSHVVKLTEATFESFITSNPHVLAEFFAP
WCGHCKKLGPELVSAAEILKDNEQVKIAQIDCTEEKELCQGYEIKGYPTLKVFHGEVEVP
SDYQGQRQSQSIVSYMLKQSLPPVSEINATKDLDDTIAEAKEPVIVQVLPEDASNLESNT
TFYGVADETHLVHWIDIESKPLFGDIDGSTFKSYAEANIPLAYYFYENEEQRAAAADIIK
PFAKEQRGKINFVGLDAVKFGKHAKNLNMDEEKLPLFVIHDLVSNKKFGVPQDQELTNKD
VTELIEKFIAGEAEPIVKSEPIPEIQEEKVFKLVGKAHDEVVFDESKDVLVKYYAPWCGH
CKRMAPAYEELATLYANDEDASSKVVIAKLDHTLNDVDNVDIQGYPTLILYPAGDKSNPQ
LYDGSRDLESLAEFVKERGTHKVDALALRPVEEEKEAEEEAESEADAHDEL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcaactggaatattaaaactgtggcaagtattttgtccgctctcacactagca
caagcaagtgatcaggaggctattgctccagaggactctcatgtcgtcaaattgactgaa
gccacttttgagtctttcatcaccagtaatcctcacgttttggcagagttttttgcccct
tggtgtggtcactgtaagaagttgggccctgaacttgtttctgctgccgagatcttaaag
gacaatgagcaggttaagattgctcaaattgattgtacggaggagaaggaattatgtcaa
ggctacgaaattaaagggtatcctactttgaaggtgttccatggtgaggttgaggtccca
agtgactatcaaggtcaaagacagagccaaagcattgtcagctatatgctaaagcagagt
ttaccccctgtcagtgaaatcaatgcaaccaaagatttagacgacacaatcgccgaggca
aaagagcccgtgattgtgcaagtactaccggaagatgcatccaacttggaatctaacacc
acattttacggagttgccgatgagactcatttggtgcactggattgatattgagtccaaa
cctctatttggagacattgacggatccaccttcaaatcatatgctgaagctaacatccct
ttagcctactatttctatgagaacgaagaacaacgtgctgctgctgccgatattattaaa
ccttttgctaaagagcaacgtggcaaaattaactttgttggcttagatgccgttaaattc
ggtaagcatgccaagaacttaaacatggatgaagagaaactccctctatttgtcattcat
gatttggtgagcaacaagaagtttggagttcctcaagaccaagaattgacgaacaaagat
gtgaccgagctgattgagaaattcatcgcaggagaggcagaaccaattgtgaaatcagag
ccaattccagaaattcaagaagagaaagtcttcaagctagtcggaaaggcccacgatgaa
gttgtcttcgatgaatctaaagatgttctagtcaagtactacgccccttggtgtggtcac
tgtaagagaatggctcctgcttatgaggaattggctactctttacgccaatgatgaggat
gcctcttcaaaggttgtgattgcaaaacttgatcacactttgaacgatgtcgacaacgtt
gatattcaaggttatcctactttgatcctttatccagctggtgataaatccaatcctcaa
ctgtatgatggatctcgtgacctagaatcattggctgagtttgtaaaggagagaggaacc
cacaaagtggatgccctagcactcagaccagtcgaggaagaaaaggaagctgaagaagaa
gctgaaagtgaggcagacgctcacgacgagctttaa

DBGET integrated database retrieval system