KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0110Help
Entry
PPUBIRD1_0110     CDS       T01975                                 

Gene name
trpA
Definition
(GenBank) TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00260  Glycine, serine and threonine metabolism
ppb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01130  Biosynthesis of antibiotics
ppb01230  Biosynthesis of amino acids
Module
ppb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPUBIRD1_0110 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPUBIRD1_0110 (trpA)
Enzymes [BR:ppb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PPUBIRD1_0110 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PEP_mutase ThiG KDGP_aldolase BtpA Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADR57819
Position
complement(118382..119191)
Genome map
AA seq 269 aa AA seqDB search
MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGYYNPIHRFGVDTFVAQAKE
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAANIARLADGVVVGSALVDKI
AQAKSADQAVSDVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaacaacgcttcgccgagctgaaggccgaaggccgctcggcactggtc
accttcgtaacagctggcgacccgggctacgacgcctcgttgcagatcctcaagggcctg
ccggctgctggcgccgacgtgatcgagctgggcatgccgttcaccgacccgatggccgat
ggcgtggccatccagcttgccaccctgcgcgcccttgaagctggccagaccttggccaag
accctgcagatggttcgcgaattccgtgtggataaccagaccacaccgatcgtgctgatg
ggttactacaaccctatccaccgctttggcgtggacacgttcgtggctcaagccaaggaa
gcgggcgtcgatggcctgatcatcgtcgaccttccgccagagcacgatgccgaactggct
accccggcccaggccgcaggcatcgacttcatccgcctgaccaccccgaccaccgacgac
gcgcgcctgccacgcgtgctggagcgcagctccgggttcgtctactacgtgtcggtggct
ggtgtgaccggtgccggttcggcgaccaccgagcatgtgaccgaagccattgcccgcctg
cgccggcataccgatctgccgatcagcgttggcttcggcattcgcacgccggaacaggct
gcgaacattgcccgcttggccgatggcgtggtggtgggctcggcactggtcgacaagatc
gcccaagccaaaagcgccgatcaggcggtgagcgatgtattgagcctgtgctcggcattg
gctgaaggggtgcgtggcgcacgccgttaa

DBGET integrated database retrieval system