KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0157Help
Entry
PPUBIRD1_0157     CDS       T01975                                 

Definition
(GenBank) Diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ppb  Pseudomonas putida BIRD-1
Brite
Enzymes [BR:ppb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PPUBIRD1_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
163009..164946
Genome map
AA seq 645 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDECMKEMRD
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMHQVSDALTALVGQLQSLPLPSDISRPL
KKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKSGEEARPGFLQRLFGSREEDAQA
GAALAPVALPAAEVVPQAAGSAEPSRPDDVDALQPLPAPAAPAAEVAEAPELELEAFGPA
LIETAEMPPAPLPRDKSPLPEAAVSASEPLAEAEPLQALEVTFGEDGPYALPYAVEPPYS
QVAAHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAITDS
GQHEFETYLQQLNERLEGFQSHLHEASAGHADNSTAARELDSQLREHVDGLQSSMQGAAD
VDSLKHILENRLEGLLVTMDEHKHERDRREQELAGRLQGLSERVASMEHEALGYREHLEE
QRQKALLDPLTGLPNRAAWSERVEREMLDWQENGGHLAMAILDLDHFKRINDNYGHLAGD
KVLKIVADQLRKRLRGRDFIARFGGEEFVLLLPQTTPAVAAQVAEVLRATVEACPFHFKG
ERVVITTSIGLSAFRSGERSDQVLKRADAALYRAKELGRNRVEHG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaataccttaaaagcatcgagcagcaagaa
aagctcgaacgccgttgggatgcccgtcttgacctgctgcgccgaggcctggtgcgcagc
accctggctgctgaaggcagtgacaaggtggtagacgagtgcatgaaggaaatgcgcgat
gtcattcgcagcgacaacatggacgccggcctcgctggcttgattccgcgccttgagaaa
gcggtactggattccgaacagcgtcgcgaaacccgcatgcaccaggtcagcgatgcgctg
accgcactggttggccaactgcaaagcctgcccctgcccagcgatatctcgcggccattg
aaaaaactggcgaagaagctcgacggcggggttgcccagtcacgcgagctgccgccgctt
ttgggcgagttgagcggcttgcaggggcgcgcgctgtcggcccttggcaagtcgggtgaa
gaagcccgacccggttttctgcagcggttgtttggaagccgcgaggaagatgcacaggca
ggagcagcgcttgcgccggtggcgttgcctgctgccgaggttgtgccccaggcagccggc
agtgccgagccctcgcggccagatgacgtcgatgcgctacaaccgttgccggcccctgct
gctccggctgccgaggtggccgaagcgcccgagcttgagctggaggcatttggcccggcg
ctgatcgaaacggccgaaatgccgcctgccccgttgccaagggacaagtcgccattgccg
gaagctgcagtttccgccagcgagccgttggctgaggcagaacccttacaagcccttgaa
gtaacctttggtgaagacggcccctatgccctgccctacgcagtggagccgccttacagc
caggttgccgcgcacatcgagcagaccctgatcggtctgctcgatgacctcagccttccc
gagcgacacaaggctcaggcgctggagatgcgcgagcgggttgctcgcggcttgaactgg
tatgagctgatcccggtgctggatgacttggcagtactcatgctggcgattaccgacagc
ggtcagcacgaattcgaaacctacctgcagcaactcaatgaacgcctggaaggtttccag
agccacctgcacgaggccagcgccggccacgcggacaacagcactgctgcccgcgagctg
gatagccaactgcgagagcacgtcgacggcctgcagagcagcatgcaaggtgccgccgat
gtagacagcctcaagcacattctggaaaaccgcctggaaggcttactggtgacgatggac
gagcacaagcacgagcgtgatcgccgcgagcaggaactggccggtcgcctgcaaggcttg
tcggagcgggtggcgagcatggagcatgaggcgcttggctaccgcgagcacctggaagaa
cagcgccagaaagccctgctggacccgctcaccggcctgcccaaccgtgcggcctggagc
gagcgagtcgaacgcgaaatgcttgactggcaggaaaacggcggccatctggcgatggcg
attcttgacctggaccatttcaaacgcatcaacgacaactatggtcatctggctggggac
aaggtcctcaagatcgtggccgaccagttgcgcaagcgtctgcggggccgtgatttcatc
gcccgctttggcggcgaggaattcgtcctgctgctgccgcagaccacgccggcagtcgct
gcgcaagtggccgaggtgttgcgtgccacagtcgaagcctgcccattccacttcaaggga
gaacgggtggtgatcaccacctccatcggcctgagtgcattccgttctggcgaacgcagc
gaccaggtgctcaaacgggccgatgcagcgctgtaccgggcaaaggagctggggcgcaat
cgcgtcgagcatggttag

DBGET integrated database retrieval system