KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0157Help
Entry
PPUBIRD1_0157     CDS       T01975                                 

Definition
Diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
ppb  Pseudomonas putida BIRD-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
163009..164946
Genome map
AA seq 645 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDECMKEMRD
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMHQVSDALTALVGQLQSLPLPSDISRPL
KKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKSGEEARPGFLQRLFGSREEDAQA
GAALAPVALPAAEVVPQAAGSAEPSRPDDVDALQPLPAPAAPAAEVAEAPELELEAFGPA
LIETAEMPPAPLPRDKSPLPEAAVSASEPLAEAEPLQALEVTFGEDGPYALPYAVEPPYS
QVAAHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAITDS
GQHEFETYLQQLNERLEGFQSHLHEASAGHADNSTAARELDSQLREHVDGLQSSMQGAAD
VDSLKHILENRLEGLLVTMDEHKHERDRREQELAGRLQGLSERVASMEHEALGYREHLEE
QRQKALLDPLTGLPNRAAWSERVEREMLDWQENGGHLAMAILDLDHFKRINDNYGHLAGD
KVLKIVADQLRKRLRGRDFIARFGGEEFVLLLPQTTPAVAAQVAEVLRATVEACPFHFKG
ERVVITTSIGLSAFRSGERSDQVLKRADAALYRAKELGRNRVEHG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaataccttaaaagcatcgagcagcaagaa
aagctcgaacgccgttgggatgcccgtcttgacctgctgcgccgaggcctggtgcgcagc
accctggctgctgaaggcagtgacaaggtggtagacgagtgcatgaaggaaatgcgcgat
gtcattcgcagcgacaacatggacgccggcctcgctggcttgattccgcgccttgagaaa
gcggtactggattccgaacagcgtcgcgaaacccgcatgcaccaggtcagcgatgcgctg
accgcactggttggccaactgcaaagcctgcccctgcccagcgatatctcgcggccattg
aaaaaactggcgaagaagctcgacggcggggttgcccagtcacgcgagctgccgccgctt
ttgggcgagttgagcggcttgcaggggcgcgcgctgtcggcccttggcaagtcgggtgaa
gaagcccgacccggttttctgcagcggttgtttggaagccgcgaggaagatgcacaggca
ggagcagcgcttgcgccggtggcgttgcctgctgccgaggttgtgccccaggcagccggc
agtgccgagccctcgcggccagatgacgtcgatgcgctacaaccgttgccggcccctgct
gctccggctgccgaggtggccgaagcgcccgagcttgagctggaggcatttggcccggcg
ctgatcgaaacggccgaaatgccgcctgccccgttgccaagggacaagtcgccattgccg
gaagctgcagtttccgccagcgagccgttggctgaggcagaacccttacaagcccttgaa
gtaacctttggtgaagacggcccctatgccctgccctacgcagtggagccgccttacagc
caggttgccgcgcacatcgagcagaccctgatcggtctgctcgatgacctcagccttccc
gagcgacacaaggctcaggcgctggagatgcgcgagcgggttgctcgcggcttgaactgg
tatgagctgatcccggtgctggatgacttggcagtactcatgctggcgattaccgacagc
ggtcagcacgaattcgaaacctacctgcagcaactcaatgaacgcctggaaggtttccag
agccacctgcacgaggccagcgccggccacgcggacaacagcactgctgcccgcgagctg
gatagccaactgcgagagcacgtcgacggcctgcagagcagcatgcaaggtgccgccgat
gtagacagcctcaagcacattctggaaaaccgcctggaaggcttactggtgacgatggac
gagcacaagcacgagcgtgatcgccgcgagcaggaactggccggtcgcctgcaaggcttg
tcggagcgggtggcgagcatggagcatgaggcgcttggctaccgcgagcacctggaagaa
cagcgccagaaagccctgctggacccgctcaccggcctgcccaaccgtgcggcctggagc
gagcgagtcgaacgcgaaatgcttgactggcaggaaaacggcggccatctggcgatggcg
attcttgacctggaccatttcaaacgcatcaacgacaactatggtcatctggctggggac
aaggtcctcaagatcgtggccgaccagttgcgcaagcgtctgcggggccgtgatttcatc
gcccgctttggcggcgaggaattcgtcctgctgctgccgcagaccacgccggcagtcgct
gcgcaagtggccgaggtgttgcgtgccacagtcgaagcctgcccattccacttcaaggga
gaacgggtggtgatcaccacctccatcggcctgagtgcattccgttctggcgaacgcagc
gaccaggtgctcaaacgggccgatgcagcgctgtaccgggcaaaggagctggggcgcaat
cgcgtcgagcatggttag

DBGET integrated database retrieval system