KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0392Help
Entry
PPUBIRD1_0392     CDS       T01975                                 

Gene name
glcB
Definition
(GenBank) GlcB
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00620  Pyruvate metabolism
ppb00630  Glyoxylate and dicarboxylate metabolism
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01120  Microbial metabolism in diverse environments
ppb01200  Carbon metabolism
Module
ppb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPUBIRD1_0392 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PPUBIRD1_0392 (glcB)
Enzymes [BR:ppb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PPUBIRD1_0392 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF3355
Motif
Other DBs
NCBI-ProteinID: ADR58087
Position
complement(457051..459228)
Genome map
AA seq 725 aa AA seqDB search
MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIINDLAPKNKALLAKRDEL
QAKIDAWHQARKGQAHDAAAYKAFLQEIGYLLPQADDFQATTQNVDEEIAHMAGPQLVVP
VMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGYNKIRGDKVIAFARAFLDEAA
PLAAGSHVDSTGYRIEGGKLVVALKGGSNTGLRDDAQLIGFHGDAAAPTAVLLKHNGLHF
EIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDSVAAVDADDKVIVYRNWLGLMKGDL
AESVSKGGKTFTRTMNPDREYAAPNGGSVTLHGRSLLFVRNVGHLMTNPAILDAQGNEIP
EGIQDGLFTNLIALHNLNGNTSRKNTRSGSVYIVKPKMHGPEEVAFAAEIFSQVEDLLGM
PRNTVKVGIMDEERRTTVNLKSCIKAAAERVAFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKNEKWIGAYENNNVDVGLATGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAATLHALHYHKVDVQARQRELASRTPASVDDILAIPLAADTNWSAEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQLLANWLRHGVVSQEQVLESL
KRMAVVVDQQNAGDPLYRPMAPNFDDNVAFQAAVELVVEGGKQPNGYTEPVLHRRRREFK
ARNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactggatacgttcaagtcggtggccttcaggtcgccaaggtcctgtacgacttcgtg
aacaacgaagccatccccgggaccggcatcgtcgccgagcagttctgggcgggtgcagag
aagatcatcaatgacctcgctccaaagaacaaagccctgctcgccaagcgcgacgagctg
caagccaagatcgacgcctggcaccaggcacgcaaaggccaggcccacgacgccgcagcc
tacaaagcattcctccaggaaatcggctacctgctgccacaagccgacgatttccaggcc
accacccagaatgtggacgaagaaatcgcccacatggccggtccacaactggtcgtgccg
gtgatgaacgcccgcttcgccctgaacgccgccaacgcccgctggggttcgctgtacgat
gccctgtacggcaccgacgccatcagcgatgaaggcggcgccgaaaaaggccagggttac
aacaagatacgcggcgacaaggtcatcgccttcgcccgcgccttcctcgacgaagccgcg
ccactggccgccggctcgcacgtcgactccacgggctatcgcatcgaaggcggcaagctg
gttgttgccctgaaaggcggcagcaacactggcctacgcgacgatgcgcaactgattggc
ttccacggcgacgccgccgcgcccactgctgtgctgctcaagcacaacggcctgcacttc
gaaatccaggtcgatgccagcaccccggtcggcagcaccgacgccgctggcgtcaaagac
atcctgatggagtcggcactgaccaccatcatggactgcgaagactcggttgcagccgtc
gacgctgacgacaaagtcatcgtctaccgcaactggctgggcttgatgaaaggcgacctg
gccgaaagcgtgagcaagggtggcaaaaccttcacccgcaccatgaacccggaccgcgag
tacgctgcgcctaacggcggcagcgtgaccctgcacggtcgttcgttgctgttcgtgcgc
aacgttggccacctgatgaccaacccggcgatcctcgatgcccagggcaacgaaatcccc
gaaggtatccaggacgggctgttcaccaacctgatcgccctgcacaatctcaacggtaac
actagccgcaagaatacccgcagcggcagcgtgtacatcgtcaagccgaagatgcacggc
cctgaggaagtggccttcgccgccgagatcttcagccaggtcgaagacctgctgggcatg
ccgcgcaacaccgtcaaggtcggcatcatggacgaggaacgccgtaccacggtcaacctc
aaatcctgcatcaaggcagccgccgagcgcgtggcgttcatcaataccggcttccttgac
cgcactggagatgaaatccacacctcgatggaagccggcgccgtggtgcgcaaaggtgcc
atgaagaacgagaagtggatcggcgcctacgaaaacaacaacgtcgacgttggcctggcc
accggcctgcaaggccgtgcgcagatcggcaaaggcatgtgggccatgcctgacctgatg
gccgccatgctcgagcagaagatcgcccacccactggccggtgccaacaccgcctgggta
ccgtcgccaactgccgccaccctgcacgccctgcactaccacaaggtggacgtacaggcg
cgccagcgtgaactggcttcacgtaccccggcgtcggtggatgacattctggccattccg
ctggctgccgacaccaactggtcggccgaagagatccgcaacgagctggacaacaacgcc
cagggcattctcggctacgtggtgcgctggatcgaccagggcgtgggttgctcgaaggtg
ccggacatcaacaacgtcggcctgatggaagaccgtgccaccctgcgcatctccgcccag
ctgctggccaactggctgcgccacggcgtggtcagccaggaacaggtgctggaaagcctc
aagcgcatggccgtggtggtcgatcagcagaacgctggcgaccccctgtaccgcccgatg
gcgccgaatttcgacgacaacgtggcgttccaggcggctgtggaactggtagtggaaggt
ggcaagcaaccgaacggttataccgagccggtactgcaccgccgtcgccgcgagttcaag
gcgcgtaacgggttgtaa

DBGET integrated database retrieval system