KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0431Help
Entry
PPUBIRD1_0431     CDS       T01975                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPUBIRD1_0431
Enzymes [BR:ppb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PPUBIRD1_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
500979..501488
Genome map
AA seq 169 aa AA seqDB search
MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMRCSPAFESQAVGIKSGPFINFVVTGQ
TALPLIELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLHGTFDGLVLPRAEILKNAF
VLWPLSLLAPDLVHPGVGKRMAQLWQEAQIDQVLAPVAFEWRGLQLTPA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgagcacggtttacctgggcctgggcagcaacatcgaccgtgaggcgcatttg
tgcgccgggctcgatgcgttggctggcatcctgactgacatgcgctgttcaccggccttc
gaaagccaggcggtgggcatcaagagcgggccgttcatcaacttcgtggtgaccgggcaa
accgcgttgccgttgatcgagctggaccgccggctgaagttcatcgaggccgacaatggc
cgctatgcacctgaccgcaaagggttgccgctggatatcgacgtgctgatgtatgacgat
ttgcacggtaccttcgatgggctggtattgccccgtgccgagatcctgaagaacgctttt
gtgctgtggccgctgtcgttgctggcgcccgacctggtgcatccgggggtgggcaagcgc
atggcgcagctgtggcaggaagcgcagatcgatcaggtactggccccggtggcctttgag
tggcgcgggttgcagttgacgcccgcttga

DBGET integrated database retrieval system