KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0732Help
Entry
PPUBIRD1_0732     CDS       T01975                                 

Gene name
proB
Definition
(GenBank) ProB
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00330  Arginine and proline metabolism
ppb00332  Carbapenem biosynthesis
ppb01100  Metabolic pathways
ppb01130  Biosynthesis of antibiotics
ppb01230  Biosynthesis of amino acids
Module
ppb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PPUBIRD1_0732 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PPUBIRD1_0732 (proB)
Enzymes [BR:ppb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PPUBIRD1_0732 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADR58419
Position
830900..832018
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAKRWVVKIGSALLTADGKGLDRGAMAVWVEQMVALREAGVELVLVSSGAVAAG
MSQLGWTKRPSAMNELQAAASLGQMRLVQAWESSFGEHGKHTAQILLTHDDLSDRKRYLN
ARSTLRTLVDLGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPEAQLIYEARADDPSLDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIIGG
RIERVLDRLKAGERLGTLLSPERGMIAARKQWLAGHLQTRGTLVLDAGAVQALRQANKSL
LPVGVKTVQGSFRRGEMVVCVGPDGVEVARGLANYSALEAQKIIGQSSEAIESILGYSAE
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcaaggtgacgggcgccaagcgctgggtcgttaagattggcagtgctctgctg
accgccgatggcaagggcctcgaccgcggtgcaatggccgtttgggtcgagcagatggtc
gcgctgcgtgaggcaggcgtggagttggtactggtctcctccggggccgtggctgccggc
atgagccagctgggctggaccaagcgaccgagtgcgatgaacgagctgcaggcggctgcc
tcgctcggccagatgcgtctggtgcaggcctgggagtcgagcttcggggagcacgggaag
cacaccgcgcagatcctgctgacccatgacgacctgtccgaccgcaagcgttacctgaat
gcccgcagcaccctgcgcaccttggtcgatctgggtgtggtgccggtgatcaacgaaaac
gacaccgtggtcaccgacgagatccgcttcggcgacaatgacaccctggcggcgctggtg
gccaacctggtcgaggccgacctgctggtgatcctcaccgaccgcgatggtatgttcgat
gccgacccgcgcaacaaccccgaagcgcagttgatctacgaagcccgcgccgacgaccct
tcactggatgccgtggccggtggtaccggtggtgccctgggccgtggcggcatgcagacc
aagctgcgtgcggcgcgcctggctgcccgttccggtgcccacaccatcattatcggtggc
cgcatcgagcgcgtgctggaccgcctgaaggcgggtgagcgcctgggcaccttgctgtcc
cctgagcgcggcatgatcgctgcgcgcaagcagtggctggccggtcacctgcaaacccgt
ggcaccctggtgctggatgccggtgccgtgcaagcgctgcgtcaggccaacaagagcttg
ctgccagttggcgtgaagacagtgcagggcagcttccgtcgtggcgagatggtggtgtgc
gtcggcccggacggtgttgaagtggctcgcggcctggccaactacagcgccctggaggcg
cagaagatcattggtcagtcgtccgaagccatcgagtcgatccttggctacagcgccgag
ccggaacttgtacaccgcgacaacctggtgctggtatga

DBGET integrated database retrieval system