KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0769Help
Entry
PPUBIRD1_0769     CDS       T01975                                 

Gene name
ipk
Definition
Ipk (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPUBIRD1_0769 (ipk)
Enzymes [BR:ppb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PPUBIRD1_0769 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(870963..871823)
Genome map
AA seq 286 aa AA seqDB search
MQKLTLPAPAKLNLWLHIIGRRADGYHELETVFQFLDHGDELSFALRDDGVIRLHTEIET
VPHDSNLIVRAARMLQAQSGTTLGADIWLTKVLPMGGGIGGGSSDAATTLLALAHLWQLD
WDEDRLAALGLSLGADVPVFVRGHAAFAQGVGEQLTPVDPIEPWYVVLVPQVSVSTVEIF
SHPQLTRDSLPLKMRPVPEGNSRNDCQPVVEQNYPEVRNALNSLGKFTEARLTGTGSCVF
GAFPSKAEADKVLALLSATQTGFVAKGSNVSMLHRKLQSLVKKSSA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagctcaccctgcccgccccggccaagctcaacctgtggctgcacatcatcggc
cgccgcgcggacggttaccacgagctggaaacggtgttccagtttctcgaccacggcgac
gaactgagcttcgccctgcgtgacgatggcgtgatccgcttgcacaccgaaatcgagaca
gtcccccacgacagcaacctgatcgtacgggccgcacgcatgctacaagctcaatcgggc
accacgcttggcgccgacatctggctgaccaaggttctgcccatgggcggtggcatcggc
ggcggcagctcggacgccgcgaccaccctgctggccctcgcccacctgtggcaactggac
tgggacgaagaccgcctggccgcactgggcctgagcctgggcgccgatgtgccggtgttc
gtacgcggccacgcagcattcgcgcaaggcgtaggcgaacaactgaccccggtcgacccg
atcgaaccctggtatgtcgtgctggtgccgcaagtgtctgtcagcacagtagaaattttt
tcacatccacagttgacacgtgattctctcccccttaagatgcgccccgttcccgaggga
aacagtcgaaatgactgccaaccggtggtagagcagaattaccctgaagttcgcaatgcg
ttgaattcactgggaaaattcactgaggctcgactaaccggcactggaagttgtgtgttt
ggggccttcccaagcaaagccgaagctgataaagttctggcccttctttcagcgacccaa
acagggtttgtggcgaaaggaagcaatgtttcgatgttgcatcgcaagctgcaaagtctg
gtcaagaagtcgagcgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system