KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_0822Help
Entry
PPUBIRD1_0822     CDS       T01975                                 

Definition
Glutathione peroxidase, putative
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PPUBIRD1_0822
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PPUBIRD1_0822
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PPUBIRD1_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925801..926283
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLKLEALNGGELPLAPFKGQVVLVVNVASKCGLTPQYKALENLYQIYKDKGFNVL
GLPCNQFAGQEPGSEKEIQDFCSLNYGVSFPLGGKLEVNGPQRHSLYRLLAGEGAEFPGD
ITWNFEKFLVGKDGRVLARFSPRTAPDDPAVVQAIEKALA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatttcacgacctgaaactggaagcgctgaacggcggagagctgcccctcgca
cccttcaagggccaagtggtgctggtggtcaacgttgcctccaaatgtggcctgacgccg
caatacaaggccctggagaacctctaccagatctacaaggacaagggcttcaatgtgctt
ggcctgccgtgcaaccagtttgccgggcaggaaccgggtagcgaaaaggaaatccaggac
ttctgcagcctcaactacggggtcagcttcccgctggggggcaagctggaggttaacggg
ccgcagcgccattcgttgtaccgcctgctggcaggtgagggggccgagttccccggtgac
attacctggaatttcgagaagtttctggtgggcaaggatggccgggtgctggcgcgtttc
tcgccgcgcacggcgccggatgacccggcggtggtgcaggccatcgagaaagccctggcc
tga

DBGET integrated database retrieval system