KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1017Help
Entry
PPUBIRD1_1017     CDS       T01975                                 

Gene name
murA
Definition
MurA (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PPUBIRD1_1017 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PPUBIRD1_1017 (murA)
Enzymes [BR:ppb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     PPUBIRD1_1017 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144006..1145271
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGARLDGEIRISGAKNAALPILAATLLADGPVTVGNLPHLHDITTMIELFGRM
GIEPVIDEKLSVEIDPRTIKTLVAPYELVKTMRASILVLGPMVARFGEAEVALPGGCAIG
SRPVDLHIRGLEAMGAKIEVEGGYIKAKAPEGGLRGAHFFFDTVSVTGTENIMMAAALAK
GRSVLQNAAREPEVVDLANFINAMGGNIQGAGTDTITIDGVERLDSANYRVMPDRIETGT
YLVAAAVTGGRVKVKDTDPTILEAVLEKLKEAGADINTGEDWIELDMHGKRPKAVNLRTA
PYPAFPTDMQAQFISLNAIAEGTGAVIETIFENRFMHVYEMHRMGAQIQVEGNTAIVTGV
KALKGAPVMATDLRASASLVLSALVAEGDTLIDRIYHIDRGYECIEEKLQMLGAKIRRVP
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactgattattactggcggcgctcgccttgacggcgagatccgcatttcgggc
gcgaagaacgcagccctgccgattctggcagcgaccctgctggccgatggcccggtcacc
gtgggcaacctgccgcacctgcacgacatcaccaccatgatcgagctgttcgggcgcatg
ggcatcgagcctgtgatcgacgaaaagctgtcggtggagatcgatccacgcaccatcaag
accctggtcgcgccgtacgagctggtcaagaccatgcgcgcctcgatcctggtgctgggc
ccgatggttgcccgtttcggcgaagccgaagtggccctgcctggcggttgcgccattggc
tcgcgcccggtcgatctgcacatccgtggccttgaggccatgggggcgaagattgaagtg
gaaggcggctacatcaaggccaaggcgcctgaaggtggcctgcgtggcgcgcacttcttc
ttcgacaccgtcagcgtgaccggtaccgagaacatcatgatggccgctgccttggccaag
ggccgcagcgtgttgcagaacgccgcgcgtgagcctgaagtggtcgatctggccaacttc
atcaacgccatgggcgggaacattcagggcgccggtaccgacaccatcaccatcgatggt
gtcgaacgactggattcggccaactaccgcgtgatgccggaccgcatcgagaccggtacc
tacctggttgccgctgccgtgaccggtggccgcgtcaaggtcaaggacaccgaccctacc
atcctcgaagccgtgcttgaaaaactgaaggaagcgggtgccgacatcaacaccggcgag
gactggatcgaactggacatgcatggcaagcggccgaaagccgtgaatctgcgtactgcc
ccgtatccggcgttcccgaccgacatgcaggcgcagttcatctcgctgaatgccattgcc
gaaggcactggcgcggtaatcgagaccatcttcgaaaaccgcttcatgcatgtttacgaa
atgcaccgcatgggcgcgcagatccaggtcgaaggcaacaccgccatcgtcactggcgtc
aaggcgctgaagggtgccccggtcatggccaccgacctgcgtgcttccgccagcctggtg
ctgtcggcgctggttgccgaaggcgataccctgatcgatcgcatctaccacatcgaccgt
ggttacgagtgcatcgaggaaaaactgcagatgctcggcgcgaaaatccgccgcgtaccg
ggctag

DBGET integrated database retrieval system