KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1061Help
Entry
PPUBIRD1_1061     CDS       T01975                                 

Gene name
glk
Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPUBIRD1_1061 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPUBIRD1_1061 (glk)
   00052 Galactose metabolism
    PPUBIRD1_1061 (glk)
   00500 Starch and sucrose metabolism
    PPUBIRD1_1061 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PPUBIRD1_1061 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PPUBIRD1_1061 (glk)
   00524 Butirosin and neomycin biosynthesis
    PPUBIRD1_1061 (glk)
Enzymes [BR:ppb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PPUBIRD1_1061 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1194158..1195117
Genome map
AA seq 319 aa AA seqDB search
MKHLLVGDIGGTNARFALWRDNQLHEVNVFATADYTNPEQAIEAYLETQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRTAFCKTLQVERLLLINDFTAMALGMTRLREGEFREVC
PGQADPSRPALVIGPGTGLGVGSLLRLGEQLWKALPGEGGHVDLPVGNAREAAIHQQIHS
QIGHVSAEAVLSGGGLVRLYQAICALDGDTPRHKTPAHITDAALGGEPRALAVVEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFNGVPVWLVT
AEYSGLEGAGVALQQALDH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacctgctggttggtgatattggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctgcatgaggtaaacgttttcgccactgcggactacaccaacccggagcag
gccatcgaggcttacctggaaacccaaggtatcgcccgtggtggcctggcggcggtgtgc
ctggcggtggccggcccggtcgatggcgatgaatttcgcttcaccaacaaccactggcgc
ctgagccgcacggcattttgcaagaccttgcaggtcgagcgactgttgctgatcaatgat
ttcaccgcaatggcgctgggcatgacgcgtctgcgcgaaggcgagttccgcgaggtgtgc
cccggccaggccgacccctcgaggccggcactggtgatcgggccaggtactggcctgggt
gtgggctcgctgctgcgcctgggcgaacagctctggaaggccctgccgggtgaaggcggg
catgttgacctgccggtaggcaatgctcgcgaagcggcaatccaccagcagatccacagt
cagatcggccatgtcagcgccgaggccgtgctcagtgggggtggcctggtgcggctgtac
caggcgatctgtgcgctggacggcgacacgcccaggcacaagaccccggcgcatatcacc
gatgccgcactgggcggtgagcctcgtgcgctggcggtggtcgagcaattctgtcgtttc
cttgggcgagtggcgggtaacaatgtgctgacgctgggcgcgcgaggcggggtttacatt
gtgggcggtgtgattccgcgctttgccgagctgttcctgcgtagcgggtttgccgcgagt
tttgccgacaaggggtgtatgagtggctatttcaacggggtgccggtgtggctggtgacg
gcggaatattccgggttggagggggcaggggtagcgttgcagcaggcgttggatcactga

DBGET integrated database retrieval system