KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1414Help
Entry
PPUBIRD1_1414     CDS       T01975                                 

Definition
Acetyl-coenzyme A synthetase 1 (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPUBIRD1_1414
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPUBIRD1_1414
   00620 Pyruvate metabolism
    PPUBIRD1_1414
   00640 Propanoate metabolism
    PPUBIRD1_1414
  Energy metabolism
   00680 Methane metabolism
    PPUBIRD1_1414
Enzymes [BR:ppb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PPUBIRD1_1414
Lipid biosynthesis proteins [BR:ppb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PPUBIRD1_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1582762..1584723
Genome map
AA seq 653 aa AA seqDB search
MSAAPLYPVRPEVAATTLTDEATYKAMYQQSVINPDGFWREQAQRIDWIKPFTKVKQTSF
DDHHVDIKWFADGTLNVSSNCLDRHLEERGDQLAIIWEGDDPSEHRNITYRELHEQVCKF
ANALRGQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCKS
KVVITADEGVRGGRRTPLKANVDLALTNPETSSVQKIIVCKRTGGDIAWHQHRDIWYEDL
MKVASSHCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLVYAALTHERVFDYRPGEV
YWCTADVGWVTGHSYIVYGPLANGATTLLFEGVPNYPDITRVSKIVDKHKVNILYTAPTA
IRAMMAEGQAAVEGADGSSLRLLGSVGEPINPEAWNWYYKTVGKERCPIVDTWWQTETGG
ILISPLPGATGLKPGSATRPFFGVVPALVDNLGNLIDGAAEGNLVILDSWPGQSRSLYGD
HDRFVDTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHS
KVAEAAVVGVPHDIKGQGIYVYVTLNAGIEASEQLRLELKNWVRKEIGPIASPDVIQWAP
GLPKTRSGKIMRRILRKIATGEYDALGDISTLADPGVVQHLIDTHKAMNLASA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggctccactgtatcccgttcgtcccgaggttgcggccactaccctgaccgac
gaggccacctacaaggccatgtaccagcaatcggtgatcaacccggacggcttctggcgc
gagcaggcccagcgtatcgactggatcaagccgttcaccaaggtcaaacagacctccttc
gacgaccaccatgtcgatatcaaatggttcgccgacggcactctgaacgtttcctccaac
tgcctggaccgccaccttgaagagcgcggtgaccagttggccatcatctgggaaggtgac
gacccttccgagcaccgcaacatcacttaccgcgagttgcacgagcaggtctgcaagttc
gccaacgccctgcgtggccaggatgtgcaccgcggtgacgtggtcaccatctatatgccg
atgatccccgaagcggtggtcgccatgctggcctgtgcacgcattggtgcgattcactcg
gtggtgttcggcggcttctcgcccgaggcgctggctggccgtatcatcgactgcaagtcc
aaggtggtgatcactgccgacgaaggcgtgcgtggtggccgccgtaccccgctcaaggcc
aacgtcgacctggcgctgaccaaccctgaaaccagcagcgttcagaaaatcatcgtgtgc
aagcgcaccggtggcgacattgcctggcaccagcaccgcgacatctggtacgaagacctg
atgaaggtggcctccagccactgtgcacccaaagaaatgggcgctgaagaggcgctgttc
atcctttatacctccggctccaccggcaagccgaagggcgtgctgcacaccacaggcggt
tacctggtttacgccgcgctgacccatgaacgcgtgttcgattaccgcccgggggaggtg
tactggtgcaccgcggacgtcggttgggtcacaggccacagctatatcgtctacggcccg
ctggccaacggcgccaccaccttgctgttcgaaggcgtgcccaactaccctgacattacc
cgcgtatcgaagatcgtcgacaagcacaaggtcaacatcctctacacggcgccaactgcc
attcgcgccatgatggctgaagggcaggcagctgttgagggcgccgacggttccagtctg
cgtctgctgggatcggtgggtgagccgatcaaccctgaagcctggaactggtactacaaa
accgtcggcaaggagcgttgcccgatcgtcgacacctggtggcagaccgagaccggcggc
atcctgatcagcccgctgcctggtgccaccggcctcaagccgggttcggcaacccgcccg
ttcttcggtgtggtgcctgcactggtcgataacctgggcaacctgatcgacggtgctgcc
gaaggcaacctggtaatcctcgactcctggccgggccagtcgcgttcgctgtacggcgac
catgaccgcttcgtcgacacctacttcaagaccttccgtggcatgtacttcaccggcgac
ggtgcgcgccgcgacgaggacggttactactggatcaccggccgtgtggatgacgtgctc
aacgtgtccggccaccgcatgggcactgccgagattgaaagcgccatggtcgcgcactcg
aaggttgccgaggctgcagtggttggcgtgccgcatgacatcaaagggcagggcatttat
gtgtatgtcaccctcaatgccggcatcgaggccagcgagcaattgcgcctggagctgaag
aactgggtgcgcaaggagatcggcccgattgcttcgccggatgtgatccagtgggcgccg
gggctgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccacc
ggtgagtacgacgccctgggcgatatctcgaccttggccgacccaggtgtggtgcagcac
ctgatcgatacccacaaggcgatgaacctggcttcggcctaa

DBGET integrated database retrieval system