KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1589Help
Entry
PPUBIRD1_1589     CDS       T01975                                 

Gene name
recR
Definition
RecR protein
Orthology
K06187  
recombination protein RecR
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PPUBIRD1_1589 (recR)
DNA repair and recombination proteins [BR:ppb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PPUBIRD1_1589 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1774272..1774874
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDGLRILPGVGQKTAQRMALQLLERDRSGGLRLAQALTQAMEGVGHCRQC
RTLTEQELCPQCADPRRDDTQLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMARIEEQGTFTEVILATNPTVEGEATAHYIAQLLSEKGLVASRIAHGVPLGGEL
EMVDGGTLAHAFAGRRPISL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccctctcatccgccaactgatcgacggcctgcgcatcttgccaggcgtt
ggccagaaaaccgcccagcgcatggccctgcaactgctcgagcgcgaccgcagtggcggg
ctgcgcctggctcaggccttgacccaggccatggaaggggtagggcattgccgccagtgt
cgcaccctcaccgagcaggaactgtgcccgcagtgcgccgacccgcgccgtgacgacacc
cagctgtgcgtggtcgaggggccgaccgatgtgtatgcggtggagcagacgggctaccgt
ggccgttacttcgtgctcaaggggcacctgtcgccgctggatggcctggggcctgaggcg
atcggtattccgcagctgatggcgcggatcgaagagcagggcacctttaccgaggtgatc
ctggcgaccaacccgacagtggagggggaggcgacggcgcattacattgcccagttgctg
agcgagaagggcttggtggcgtctcgcattgcccatggtgtgccactgggcggcgagctg
gagatggtggacggcggtaccctggcccatgcctttgcagggcgccggcccatttcgctc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system