KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1660Help
Entry
PPUBIRD1_1660     CDS       T01975                                 

Gene name
sdhD
Definition
SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPUBIRD1_1660 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPUBIRD1_1660 (sdhD)
   00650 Butanoate metabolism
    PPUBIRD1_1660 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PPUBIRD1_1660 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1880933..1881301
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFLFLIGYVVAHPGIDYTQWHGLFSNNAMRIF
SLLALVALGAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcacgaacctgtcgcgttcgggcctctatgactggatggcgcagcgc
gtttctgcggtcgttctcgcggcttacttcctcttcctgatcggctacgtggtcgcccac
ccaggcatcgactacacccagtggcatggtctgttctccaacaacgcgatgcggatcttc
agtctgctggccctcgttgccctgggcgctcacgcctgggtcggcatgtggaccattgca
accgactacctgacgcctatgtcgttcggcaagtcggcaactgcgattcgtttcctgttc
caggcggtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system