KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1660Help
Entry
PPUBIRD1_1660     CDS       T01975                                 

Gene name
sdhD
Definition
(GenBank) SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00020  Citrate cycle (TCA cycle)
ppb00190  Oxidative phosphorylation
ppb00650  Butanoate metabolism
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01120  Microbial metabolism in diverse environments
ppb01130  Biosynthesis of antibiotics
ppb01200  Carbon metabolism
Module
ppb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPUBIRD1_1660 (sdhD)
   00650 Butanoate metabolism
    PPUBIRD1_1660 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PPUBIRD1_1660 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADR59328
Position
1880933..1881301
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFLFLIGYVVAHPGIDYTQWHGLFSNNAMRIF
SLLALVALGAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcacgaacctgtcgcgttcgggcctctatgactggatggcgcagcgc
gtttctgcggtcgttctcgcggcttacttcctcttcctgatcggctacgtggtcgcccac
ccaggcatcgactacacccagtggcatggtctgttctccaacaacgcgatgcggatcttc
agtctgctggccctcgttgccctgggcgctcacgcctgggtcggcatgtggaccattgca
accgactacctgacgcctatgtcgttcggcaagtcggcaactgcgattcgtttcctgttc
caggcggtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system