KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1664Help
Entry
PPUBIRD1_1664     CDS       T01975                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00020  Citrate cycle (TCA cycle)
ppb00310  Lysine degradation
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01120  Microbial metabolism in diverse environments
ppb01130  Biosynthesis of antibiotics
ppb01200  Carbon metabolism
Module
ppb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPUBIRD1_1664
  Amino acid metabolism
   00310 Lysine degradation
    PPUBIRD1_1664
Enzymes [BR:ppb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PPUBIRD1_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ADR59332
Position
1886914..1888137
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVLEVLATADGVLGDIV
KGEGDTVLSDELLGSIVEGGAAAAPAAAAAPAAAPAAASADAGEEDPIAAPAARKLAEEN
GIDLATVAGTGKGGRVTKEDVVAAVANKKSAPAAAPAAKPAAAAAAPVVVSAGDRTEKRV
PMTRLRAKIAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGNDIVYHGFADVGVAVSSDRGLVVPVLRNAESMSLAEIENG
IATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaagccgggcgaagccgtcaagcgtgacgagctgatcgtcgacatcgag
actgacaaggttgtcctggaagtactggctactgccgatggcgtgctgggcgacatcgtc
aagggcgagggcgacacggtcctgtccgacgaattgctgggttcgatcgttgagggcggt
gctgccgctgcgcctgccgcggccgccgcgcctgcagctgctccggccgctgctagcgct
gacgccggcgaagaagacccgatcgctgccccggccgcacgcaagctggctgaagaaaac
ggcatcgacctggctactgtggcaggcaccggtaaaggcggtcgcgtcaccaaggaagac
gtggttgctgctgttgccaacaagaagtcggcaccagccgctgccccggctgccaagcct
gccgctgctgccgctgccccggttgtcgtctccgctggcgaccgtaccgagaagcgtgtg
ccgatgacccgcctgcgtgccaagatcgccgagcgcctggtcgaagcccagtcgaacatg
gcgatgctgaccaccttcaacgaagtggacatgaccgaagtcatggccctgcgttcgaag
tacaaggacctgttcgagaagacccacaatggcgtgcgcctgggcttcatgtcgttcttc
gtcaaggctgctaccgaagcgctgaaacgcttcccggctgtcaacgcctcgatcgacggc
aacgacatcgtctaccacggcttcgccgacgtcggtgttgccgtgtccagcgaccgtggc
ctggtggtgccggtgctgcgtaacgccgagtcgatgagcctggctgaaatcgagaacggc
atcgctaccttcggcaagaaggcccgtgacggcaaactgtccatcgaagagatgaccggt
ggtaccttcaccatcaccaacggtggcaccttcggttcgatgatgtcgaccccgatcgtc
aacccgccgcaggccgccattctcggcatgcacaacatcatccagcgcccgatggccatc
aatggccaggtggtgattcgcccgatgatgtacctggcgctgtcgtacgatcaccgcctg
atcgacggcaaggaagcggtaaccttcctggtcactatcaagaacctgctggaagatccg
tcccgcctgctgctggacatctaa

DBGET integrated database retrieval system