KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1666Help
Entry
PPUBIRD1_1666     CDS       T01975                                 

Gene name
sucC
Definition
(GenBank) SucC
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00020  Citrate cycle (TCA cycle)
ppb00640  Propanoate metabolism
ppb00660  C5-Branched dibasic acid metabolism
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01120  Microbial metabolism in diverse environments
ppb01130  Biosynthesis of antibiotics
ppb01200  Carbon metabolism
Module
ppb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPUBIRD1_1666 (sucC)
   00640 Propanoate metabolism
    PPUBIRD1_1666 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PPUBIRD1_1666 (sucC)
Enzymes [BR:ppb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PPUBIRD1_1666 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ADR59334
Position
1889839..1891005
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEQAAEACDKIGGNEWVVKAQVHAGGRGKAGGV
KLVRSKEDAKAFAAQWLGKNLVTYQTDANGQPVSKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHETPEKILKATIDPLVGAQPFQGRELAFQLGLEGKQVQQFAKI
FVGLAKLFKDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDA
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgagtacggcctgccagtttcc
aagggtttcgcagtcgatacccctgagcaagctgcagaagcctgcgacaagatcggcggg
aacgagtgggttgtaaaagcccaggttcacgcgggtggtcgcggtaaagcgggcggcgta
aagctggttcgcagcaaggaagacgccaaggcgttcgctgcacagtggttgggcaagaat
ctggtcacctaccagaccgatgccaacggtcaacccgtctccaagattctggtcgaatcc
tgcactgacatcgccaaagagctgtacctgggcgctgtagtcgatcgttcgagccgccgt
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaagtcgctcacgaaacg
cctgagaaaatcctcaaggccaccatcgacccactggtcggcgctcagccgttccagggt
cgcgagctggctttccagctgggcttggaaggcaagcaagttcaacagtttgccaagatc
ttcgttggcctggccaagctgttcaaggatcatgacctggcgctgctggaagtgaacccg
ctggtgatcaaggccgatggcgacctgcactgcctcgatgccaagatcaacatcgacgcc
aacgccatgtaccgtcagccgaagctgaaaaccttccacgacccgtcgcaggacgacgcc
cgtgaagcccacgctgccaagttcgaactgaactacgttgcccttgaaggcaacatcggc
tgcatggtcaacggtgccggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccggccaacttcctcgacgttggcggcggtgctaccaaagagcgcgttaccgaa
gcgttcaagatcattctgtccgacagcaatgtcgcggccgttctggtcaacatcttcggc
ggcatcgttcgctgcgacatgattgccgaaggcatcatcggtgcggtgaaagaagtcggc
gtaaaagttccggtcgtcgttcgcctcgaaggcaacaacgccgaactgggcgctaaagta
ctggcagaaagcggtttgaacatcattgcggcaaccagcctgaccgacgctgctcaacaa
gttgtcaaagctgcggagggcaagtaa

DBGET integrated database retrieval system