KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1678Help
Entry
PPUBIRD1_1678     CDS       T01975                                 

Gene name
fabA
Definition
FabA (EC:4.2.1.60)
Orthology
K01716  
3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ppb01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ppb00061]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1902314..1902829)
Genome map
AA seq 171 aa AA seqDB search
MTKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMVDRITHISEEGGKYGKGELVAELDI
NPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFFLGWQGLPGRGRALGSGEVKFFGQVLPE
AKKVTYNIHIKRVLKGKLNMAIADGSVSVDGREIYTAEGLRVGVFTSTDNF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaacacgcctttactcgggaagacctgctgcgctgcagtcgcggtgagctg
ttcggcccaggtaatgcgcaactgcccgcgccgaacatgctgatggtcgatcgcatcacc
catatcagcgaagaaggcggcaagtacggcaaaggtgagttggtcgccgagctggatatc
aacccggacctgtggttcttcgcctgccatttcgaaggcgatccggtaatgccgggctgc
ctgggcctcgacgccatgtggcagctggttggcttcttcctcggctggcagggcctgccg
ggccgtggccgcgccctgggttcgggcgaggtgaaattctttggccaggtactgcctgaa
gccaagaaagtcacgtacaacattcacatcaagcgcgtcctgaagggcaagctgaacatg
gccatcgccgatggctcggtcagcgtcgacggccgcgagatctacactgccgaaggcctg
cgggtcggcgtgttcacctccactgacaatttctaa

DBGET integrated database retrieval system