KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1734Help
Entry
PPUBIRD1_1734     CDS       T01975                                 

Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ppb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ppb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1966187..1967512)
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYTAADVVRLRGSVQPEHTFARQGAEKLWKLVT
EGAHPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNAFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVPTIILAR
TDANAADLLTSDCDPYDQPFVIGERTREGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHGMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGASSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggccgagaacccg
cgctggaaaggcgtgacccgtacctacaccgccgctgatgtcgttcgcctgcgtggctcc
gtgcaacctgagcacacctttgcccgccagggtgcagaaaaactgtggaagctggttacc
gaaggtgctcacccgtccttccgccccgacaaagatttcgtcaactgcatgggcgcccta
actggcggccaggctgtacaacaggtcaaggccggtatccaggccatctacctgtccggc
tggcaggttgccgccgacaacaactcggccgagtcgatgtaccctgaccagtcgctgtac
ccggtcgattcggtaccgaccgtggtcaagcgcatcaacaacgcgttccgccgtgccgac
cagatccagtggaaagccggcaagaacccgggcgacgaaggctacatcgactacttcgcg
cccatcgtggccgacgccgaagccggttttggcggcgtattgaatgcctacgagctgatg
aagaacatgatcgaagcaggcgccgccggcgtgcacttcgaagaccagctggcctcggtt
aaaaaatgcggccacatgggcggcaaggtgctggtaccgacccaggaagccgtacagaag
ctggtagcagcgcgcctggccgctgacgtgtcgggtgtgccgaccatcatcctggcccgc
accgacgccaacgccgccgacctgctgaccagcgactgcgacccgtacgaccagccgttc
gtgattggcgagcgcacccgtgaaggcttctacaaggtccgtgccggcctcgaccaggcc
attgcccgcggcctggcctacgccccgtacgccgacctgatctggtgtgaaaccgccaag
ccagacctggacgaagcccgtcgcttcgccgaggcgatcaagaaggagtacccggaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgccacc
atcgccaagttccagcgcgaattgtcggccatgggttacaagcatcagttcatcaccctg
gccggcatccacaacatgtggcacggcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgctgacgccagcaagggctac
accttcgtggcgcaccagcaggaagtgggcactggctacttcgacgacatgaccaccgtg
atccagggtggcgcttcgtcggtgactgcgctgaccggttcgaccgaggaagagcagttc
cactga

DBGET integrated database retrieval system