KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1766Help
Entry
PPUBIRD1_1766     CDS       T01975                                 

Gene name
glgB
Definition
protein GlgB (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPUBIRD1_1766 (glgB)
Enzymes [BR:ppb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PPUBIRD1_1766 (glgB)
Exosome [BR:ppb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPUBIRD1_1766 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2004888..2007098
Genome map
AA seq 736 aa AA seqDB search
MNVTTRENGGLRQRDLDALARAEHADPFAVLGPHGDGAGGQLVRAFLPNALKVHIQARED
GRVLAEMEQGSLPGLFSAHLDKAQPYQLHIVWAGGEQVTEDPYSFGPQLGDMDLHLFAEG
NHRDLSGRFGAQPTQVDGIDGVCFSVWAPNARRVSVVGDFNNWDGRRHPMRLRHGAGVWE
LFIPRLGVGETYKFEVLGKDGILPLKADPLARATELPPSTASKVAGELSHAWQDHDWMAQ
RAQRHAYNAPLSIYELHPGSWRCELDEAGEIGRFYNWRELAERLVPYVQELGFTHIELLP
IMEHPFGGSWGYQPLSMFAPTSRYGSAEDFAAFIDACHQGGIGVLLDWVPAHFPTDEHGL
ARFDGTALYEYDNPLEGYHQDWNTLIYNLGRNEVRGFMMASALHWLKHFHIDGLRVDAVA
SMLYRDYSRKAGEWVPNRHGGRENLEAIDFIRHLNGVAAHEAPGALIIAEESTAWPGVSQ
PTQQGGLGFAYKWNMGWMHDTLHYIQNDPVHRTYHHNEMSFGLIYAYSEHFILPISHDEV
VHGKHSLIDKMPGDRWQKFANLRAYLTFMWAHPGKKLLFMGCEFGQWREWNHDSELDWYL
LQYPEHQGVQRLVGDLNRLYREVPALHEQDCQPQGFQWLIGDDAQNSVYAWLRWSSSGEP
VLVVANFTPVPREGYRIGVPFGERWQELLNSDAELYAGSNVGNLGAVASEPVASHGQPLS
LALNLPPLGVLIMKPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttacaacgcgtgaaaacggtggccttcggcaacgggacctcgacgccctggcc
cgcgccgaacacgccgatccttttgcggtactcggcccccacggcgacggcgcaggcggg
cagctggtccgcgcctttctgcccaatgccctgaaagtgcacattcaggcccgggaggac
gggcgagtccttgccgaaatggagcagggcagcctgcccgggttgttcagcgcgcacctc
gataaggcacagccctatcagcttcacatcgtctgggccggtggcgagcaggttaccgaa
gacccctacagctttggcccgcaattgggagacatggaccttcacttgttcgcggaaggc
aatcaccgcgatttgtccgggcgcttcggtgcccagccgactcaggtcgatggcatcgac
ggcgtgtgtttctcggtctgggcgccgaatgcccggcgggtgtcggtggtgggtgatttc
aacaactgggatggccgccgtcaccccatgcgcctgcgccacggtgccggggtgtgggag
ctgttcattccgcgtctgggcgtgggcgaaacctacaagttcgaagtactcggcaaggac
ggcatactgccgctgaaggccgacccgctggcccgtgccaccgagctgccgccgagcacg
gcgtccaaggtagccggtgaactcagccacgcctggcaggaccatgactggatggcgcaa
cgcgcccagcgccatgcctacaacgcgccgttgtcgatctacgagctgcacccagggtca
tggcgctgcgagctggacgaagcgggggaaatcgggcgtttctacaattggcgcgaactg
gccgagcggctggtgccctatgtgcaggaactgggctttacccacatcgaactgctgccg
atcatggagcacccgttcggcggctcctggggctatcaaccactgtcgatgttcgcgccc
acctcgcgctatggcagtgccgaggatttcgccgcgttcatcgacgcctgccaccaggga
ggcattggtgtgctgctggactgggtgccggcgcattttcccaccgacgaacatggcctg
gcgcgcttcgatggcactgcgctctacgaatacgacaaccccctggagggctaccaccag
gactggaacacgctgatctacaacctcgggcgcaatgaagtgcgcggcttcatgatggct
tcggcgctgcactggttgaagcatttccacatcgacggcctgcgcgtcgatgcggtggcc
tcgatgctgtaccgcgactactcgcgcaaggctggcgaatgggtacccaaccgccacggc
gggcgcgagaacctggaagccatcgacttcatccgccaccttaacggcgtggctgcccac
gaggcccctggcgcgctgatcatcgctgaagagtccaccgcctggcccggggtcagtcaa
cctacccaacagggcggcctgggttttgcctacaagtggaacatgggctggatgcacgac
accctgcactacattcagaacgacccggtgcaccgcacctaccaccacaacgagatgagc
ttcgggctgatctatgcctattccgagcacttcatcctgcccatttcccatgatgaggtg
gtgcacggcaagcattcgctgatcgacaagatgcccggcgaccgctggcagaagttcgcc
aatctgcgcgcctacctcaccttcatgtgggcacacccgggcaagaagctgctgttcatg
ggctgcgagttcggccagtggcgtgagtggaaccacgacagcgaactggactggtacctg
ctgcagtatcccgagcaccagggcgtgcagcgcctggtgggtgacctcaaccgcctgtac
cgcgaagtgccggcgctgcacgagcaggattgccagccgcagggcttccagtggctgatc
ggtgacgacgcacagaacagcgtgtacgcctggctgcgctggagcagcagcggcgagccg
gtgctggtggtggccaacttcaccccggtaccccgtgagggctaccgcattggcgtgccg
ttcggcgagcgttggcaggagttgctgaacagtgatgccgagctgtatgccgggtcgaac
gtgggtaatctgggggcagtggccagtgagccagtggccagccacgggcagccattatcg
ctggccctgaacctgccgccgctgggggtgttgatcatgaagcccgcctga

DBGET integrated database retrieval system