KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1896Help
Entry
PPUBIRD1_1896     CDS       T01975                                 

Definition
Alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PPUBIRD1_1896
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPUBIRD1_1896
  Lipid metabolism
   00071 Fatty acid degradation
    PPUBIRD1_1896
  Amino acid metabolism
   00350 Tyrosine metabolism
    PPUBIRD1_1896
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PPUBIRD1_1896
   00626 Naphthalene degradation
    PPUBIRD1_1896
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PPUBIRD1_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2151210..2152220)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAPGRRVDVVEKTLRPLEHGEALLKMQCCGVCHTDLHVKNGDFGDKTGVVLGHEG
IGVVQEVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCRDVKNSGYTVDGGMAEA
CIVKADYSVKVPDGLDSAAASSITCAGVTTYKAVKISNVRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNEEQLRFASEMGADLVVNPLNEDAAKFIQAKTGGAHAAVVTAVAKG
AFNSAVDALRAGGRLVAVGLPSESMDLNIPRLVLDGIEVVGSLVGTRQDLQEAFQFAAEG
KVVPKVTLRPIEHINQIFDEMLEGKIKGRMVIQFEG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgttgcaccaggccgtcgcgtggacgtggtagagaaaaccctgcgc
cctctcgaacacggcgaagcgctgctgaagatgcagtgctgcggtgtgtgccacaccgac
ctgcacgtgaaaaatggcgactttggtgacaagaccggtgtagtactgggccacgaaggt
attggcgtggtccaggaagttggcccgggcgtcacctcgctcaagccaggcgaccgtgcc
agcgttgcctggttctaccagggttgcggacattgcgaatattgcaacagcggcaacgag
accctgtgccgcgacgtgaagaattccggctacaccgtggacggcggcatggccgaggcc
tgcatcgtcaaggccgactactcggttaaagtgcccgacggcctcgactccgctgccgcc
agcagcatcacctgcgccggcgtcacgacctacaaggcagtgaaaatctccaacgtccgc
cccggccaatggatcgccatctacgggctcggcggcctgggcaacctggccctgcaatat
gccaagaatgtgttcaacgccaaagtgatcgccatcgacgtcaacgaagagcaactgcgc
ttcgccagcgagatgggcgcggatctggtcgtcaatccgctcaacgaagacgccgctaag
ttcatccaggccaagaccggtggcgcacatgctgccgtcgttactgccgtggccaaaggc
gcgttcaattctgccgtcgatgccttgcgcgctggcgggcgactggtggccgtcgggctt
ccgtcggagtccatggacctgaatattcctcgcctggtgcttgatgggatcgaagtggtg
ggctcgctggtaggtacacgccaggacctgcaggaagccttccagtttgccgctgaaggc
aaagtggtgcccaaggtaacgctgcgaccgatcgagcatatcaaccagatctttgacgag
atgctggagggcaagatcaaaggccggatggtgatacagttcgaaggctga

DBGET integrated database retrieval system