KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_2003Help
Entry
PPUBIRD1_2003     CDS       T01975                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PPUBIRD1_2003
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PPUBIRD1_2003
Enzymes [BR:ppb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PPUBIRD1_2003
Two-component system [BR:ppb02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PPUBIRD1_2003
Bacterial motility proteins [BR:ppb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PPUBIRD1_2003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2257957..2258532
Genome map
AA seq 191 aa AA seqDB search
MSGVRAVVIGASAGGVAALFQVLGTLPSAFAIPVLCVLHLPDDRHSQLAGVLQRRLHRPV
CEARDKESISSGQIYVAGPGYHLSVERDLTLSLSQEEPVHFSRPAIDFLFISAADAYGDG
LLGVLLTGANEDGARGLAYIKNNGGRTIVQDPRDAQVALMPEAALAQHQPDHILTLSGIG
QLLATLEYSAC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgtacgcgcagtggtgatcggcgcctcggcgggaggcgtggcggcattgttc
caggtgctcggcacgctgccatcggcgttcgccataccggtgctctgcgtgctgcacctg
ccggacgaccgccacagccaactggctggcgtgctgcagcggcggctgcatcggccggta
tgtgaggcacgtgacaaggagagcatcagcagcgggcagatctatgtggcggggccgggt
taccacttgtcggtggagcgcgacctgacgctgtcgctgagccaggaagaacccgtgcac
ttctcgcgcccggcgatcgatttcctgttcatctcggcggccgatgcctatggcgatggc
ctgctgggtgtgctgctcaccggggccaacgaagacggcgccaggggccttgcctacatc
aagaacaatggggggcgcacgatcgtccaggaccctcgtgacgcacaggttgccctgatg
ccggaggccgccctggcccagcaccagcccgaccatatccttactctgagcggtatcggg
cagttgctcgcgaccctggaatacagcgcatgctaa

DBGET integrated database retrieval system