KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_2291Help
Entry
PPUBIRD1_2291     CDS       T01975                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPUBIRD1_2291
Enzymes [BR:ppb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PPUBIRD1_2291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2604607..2605620
Genome map
AA seq 337 aa AA seqDB search
MSEPVQFPLAAVVGADDLKLALCLTAIDPRIGGVLIEGPRGMAKSTLARGLADLLGEGPF
VTLPLGASEERLVGTLDLDAALGQGKAQFSPGVLAQADGGVLYVDEVNLLPDTLVDLLLD
VAASGTNRIERDGISHRHSARFVLIGTMNPEEGELRPQLLDRFGLNVALEGLPEPEARQQ
IIRRRLAFDSDPQAFCAHWAQAQAQLRERCQAARQALADIALDDQALAWITERCYAAGVD
GLRADLVWLRAARAHCAWRGAAAIEEVDVEAVAEFALRHRRRMTPQANPPSAPQSPDQQP
GAGNPGEQGGQGDWGALPAQPVASGARREVPNWAKKP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacccgtacaatttccgctggcggccgtggtcggtgcagacgacctcaagctg
gcgctgtgcctgaccgccatcgaccccaggatcggtggtgtgctgatcgaagggccgcgt
ggcatggccaagagtaccctggcccgtggcctggccgacctgcttggcgaaggcccgttc
gtcaccttgccattgggcgccagtgaagagcggttggtcggcaccctcgacctggatgcc
gcgctggggcagggcaaggcgcagttttccccgggcgtgctggcccaggccgacggcggt
gtgctgtatgtcgatgaggtcaacctgctgcccgacaccttggtcgatctgttgcttgac
gtggctgccagcggcacaaaccgcatcgagcgtgacggtatctcgcatcggcacagcgcc
cgcttcgtactgatcggcaccatgaacccggaagagggcgagctgcgcccgcagttgctc
gaccgtttcggcctgaacgtggcgctggaggggttgccggagcccgaggccaggcagcag
atcattcgccgccggctggccttcgacagtgacccgcaggcgttctgcgcacactgggcc
caggcccaggcgcaactgcgcgagcgctgccaggcggcgcgccaggccctggccgacatt
gccctggatgaccaggcgctggcctggatcaccgagcgctgctacgccgccggcgtggac
ggcctgcgcgccgacctggtgtggctgcgcgctgcgcgcgcccactgtgcctggcggggg
gctgcagctatcgaagaagtggatgtcgaggcggtggccgaattcgccttgcgccatcgc
cgccgtatgacgccccaggccaatccgccgtcggcgccacagtcgcctgaccagcagcct
ggtgccggcaacccgggtgaacagggtgggcagggcgactggggggcattaccggcacag
ccggtggccagcggcgcgcgccgtgaggtgccgaactgggcaaaaaagccctga

DBGET integrated database retrieval system