KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_2732Help
Entry
PPUBIRD1_2732     CDS       T01975                                 

Definition
Cytochrome c551 peroxidase, putative (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppb  Pseudomonas putida BIRD-1
Brite
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PPUBIRD1_2732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3090277..3091275)
Genome map
AA seq 332 aa AA seqDB search
MFAQTTCRFRSVLHPQRLRRCLSLWVLLVLSVDSGAELLDEPLKPLPPIPTLAPGRVELG
RQLFNDPRLSRNGTLSCASCHRLDTYGVDGRAFSMGADGLPLAVNTPTVLNASLNFRQFW
NGRVESLEEQGNAVITSAHEMGGDWRVIEQRIAADVRYRQAFKDAYPDAVTKDNILSALA
DYQRTLLTPGARFDRYLQGDTEALTLEEKYGYQRFKDYGCIACHQGVNIGGNMFQKFGVF
GDYIADRGHPTEADQGRFNVTGEEADRGVFKVPSLRNVAMTAPYFHDGSAPTLERAIDVM
FQYQLGRIPSDEDRRLIMLFLKTLTAEKAGQP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgcagacaacctgtcgttttcgttccgttcttcacccgcagcgcttgcgacgt
tgcctgagcctgtgggtgctactcgttctgagtgtggacagcggggccgagctgctggac
gagccgctcaagccgctgcctccgattcccactctggcacctgggcgtgtcgagctgggc
cgccagctgttcaacgatccgcggttgtcgcgcaacggcacactgtcctgcgccagctgt
catcgtctggatacgtacggggtcgatggccgggcgttctccatgggtgcagatggcctg
ccgcttgcggtcaatacgccaacggtactcaatgccagtcttaatttccgacaattctgg
aatggccgggtcgagtcactcgaggagcaggggaatgccgtgatcaccagcgctcacgag
atgggcggagactggcgcgtgatcgagcagcgcatcgccgcagacgtgcgttaccgtcag
gcgttcaaggatgcctacccggacgcggtgacaaaggacaacatcctcagcgcgttggcc
gattaccaaaggacgcttcttacccctggtgcacgtttcgatcgttacctgcagggcgat
accgaagcgctcaccctggaagaaaaatacggctaccagcgcttcaaggactatggctgc
atcgcctgccaccaaggggtgaatattgggggcaacatgttccagaaatttggcgtgttc
ggcgactacatcgcggatcgcggccaccccaccgaggcggatcagggccgcttcaacgtg
accggagaggaggccgaccggggtgtgttcaaagtgccgagcctgcgcaatgtggcgatg
accgcgccctatttccacgatggctcggcgcctacgctggagcgtgcgatcgacgtgatg
ttccagtatcagcttggacgaatcccaagcgatgaggaccgcaggctcatcatgctgttt
ctcaaaacccttactgctgaaaaggcgggtcagccatga

DBGET integrated database retrieval system