KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_2821Help
Entry
PPUBIRD1_2821     CDS       T01975                                 

Gene name
hemB
Definition
HemB protein (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPUBIRD1_2821 (hemB)
Enzymes [BR:ppb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PPUBIRD1_2821 (hemB)
Exosome [BR:ppb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPUBIRD1_2821 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3180673..3181647)
Genome map
AA seq 324 aa AA seqDB search
MSNQFPSVRPRRLRQNESLRTIFQETEFRLEDLILPIFVEEGIDDFVPITSMPGVNRIPE
KLLAQEIERYARAGIKSVMTFGVSHHLDADGSDTWNENGLVARMSRICKDTVPEMVVMSD
TCFCEYTSHGHCGVLHDHGVDNDATLANLGKQAVIAAAAGADFIAPSAAMDGQVQAIRSA
LDGAGFHDTAIMAYSTKFASSLYGPFREAGGTALKGDRKSYQMNPMNRREAVRESLLDEQ
EGADVLMVKPAGAYLDVIADIRAASRLPLAAYQVSGEYAMIKFGGLAGAIDEGRVVRESI
GAIKRAGADLILTYFAMDLAREGI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccaattcccgtccgttcgtccccgccgcctgcgccagaacgagtccctgcgc
acgatcttccaggaaaccgagttccgccttgaagacctgatcctgccgatcttcgtcgaa
gagggcatcgatgatttcgtgccgatcaccagcatgcccggtgtcaaccgtatccccgag
aagctgttggcccaggaaatcgagcgctatgcccgcgccggtatcaagtcggtgatgacc
tttggcgtatcgcaccacctggatgccgatggcagcgacacctggaacgaaaacggcctg
gttgcgcgcatgtcgcgtatctgcaaggacaccgtgccggaaatggtggtgatgtccgac
acctgcttctgcgaatacaccagccacggccactgcggcgtgctgcatgaccatggcgtg
gacaacgatgccaccctggccaacctgggcaagcaggcagtcatcgccgctgctgccggt
gccgacttcattgccccctcggcggcgatggacggccaggtgcaggctatccgcagtgcc
ctggacggtgccggcttccacgacaccgcgatcatggcctactcgaccaagttcgcctcg
tcgttgtatggcccgttccgtgaggccggcggcaccgcactgaagggtgaccgcaaaagc
taccagatgaacccgatgaaccgccgcgaagcggtgcgcgagtcgctgctcgacgagcag
gaaggggcggacgtgctgatggtcaagccggccggtgcctaccttgatgtgatcgccgac
atccgcgccgcgtcgcgcctgccactggcggcgtaccaggtgagtggcgagtatgcgatg
atcaagttcggcgggctggccggtgccatcgacgaaggccgggtggtgcgcgaaagcatt
ggcgcaatcaagcgtgccggtgccgacctgatcctgacctacttcgccatggacctggcg
cgcgaaggtatctga

DBGET integrated database retrieval system