KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3053Help
Entry
PPUBIRD1_3053     CDS       T01975                                 

Definition
Endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPUBIRD1_3053
Enzymes [BR:ppb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PPUBIRD1_3053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3422774..3423889)
Genome map
AA seq 371 aa AA seqDB search
MMRQMLVGLVALGLPVFANAGSVCPWPAWERFKAELVSVDGRVIDPSDERLITTSEGQSY
ALFFALVGNDRQTFAQLLRWTSNNLAEGDLARHLPAWLWGRDGQQQWQVLDANNASDADL
WIAYSLLEAGRLWDQPAYTQLGQHLLWRIAAQTVRKLPGLGVMLLPGDYGFEDAQGTRLN
PSYLPLQLLDRFSEVDPLWGELAANTRRLWLASSPKGFAPDWLLWTPAGKPAADTKHGNA
GDYDAIRVYLWVGMLAEGAAQRRELVAHYAPMAALTQRQGLPPEQLDARSGEARGHGPAG
FSAALLPLLAASPEYVAGLAAQRQRLREQPVEAKAYYSQVLALFGQGFDEARYRFDPHGR
LLPAWSAPCSE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccagatgctggtagggctggtcgccttaggcctgcccgttttcgccaatgcc
gggtcggtttgcccatggcctgcctgggagcggttcaaggccgagctggtgagtgtggat
gggcgggtcatcgacccgagtgacgagcgcctgatcaccacctcggaagggcagagttac
gcgctgttcttcgccctggtaggcaacgaccggcaaaccttcgcgcagttgctgcgttgg
accagcaacaacctcgccgagggtgacctggcccggcatctgcctgcctggctgtggggc
cgtgacgggcagcagcagtggcaggtgctggacgccaacaacgccagcgatgccgatctg
tggatcgcctacagcctgctggaagcagggcggttgtgggaccagccggcctacacgcaa
ctgggccagcacctgctgtggcgtatcgccgcgcagaccgtgcgcaagcttccaggcctt
ggcgtgatgttgctgccaggtgactacggcttcgaagacgcccagggtacccgcctgaac
cccagctacctgccgctgcagctgctcgaccgcttcagcgaggtggaccccttgtggggt
gagctggcggccaacacgcggcgtttgtggttggcatcgtcgccaaagggctttgccccg
gactggttgctgtggacgccggccggaaaaccagcggcagacacgaaacatggcaatgcc
ggtgattatgacgccattcgtgtatacctgtgggttggcatgttggccgagggtgctgcg
caacgccgcgaactggtggcccattatgcgccgatggcggcattgacccagcgccagggg
ctacctcctgagcagttggatgcacgcagcggtgaagcccgcggccatggcccggcgggt
ttctctgcggccttgctgccattgcttgctgcctcgcctgagtacgtggccggcttggcg
gcccagcgccagcgcttgcgcgaacagccggtcgaggccaaggcgtattacagccaggtg
ctggcgctgttcggccagggcttcgacgaggcccgttaccgttttgacccgcacggccgc
ctgttgccggcctggagcgcgccatgcagcgaatga

DBGET integrated database retrieval system