KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3173Help
Entry
PPUBIRD1_3173     CDS       T01975                                 

Definition
GTP cyclohydrolase 1 2 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3565269..3565829)
Genome map
AA seq 186 aa AA seqDB search
MSHSLAEHYHEILVGIGENPQREGLLDTPQRAAKAMQYLCNGYAQNLHEVVNGALFESEN
DEMIVVRDIELYSLCEHHMLPFIGKAHVAYLPTGRVLGLSKVARVVDMFARRLQIQENLT
RQIAYAVQEVTDAAGVAVVIEAKHMCMMMRGVEKQNSVMISSVMLGAFRDAPSTRHEFLN
LIGRHN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtcacattcgttagccgagcactatcatgaaatcctggtcggtattggtgaaaacccg
cagcgcgaagggcttctggacaccccccagcgtgcggccaaagcgatgcagtacttgtgc
aacgggtatgcacagaatcttcacgaggtcgtgaacggtgctttgttcgagagtgaaaac
gatgaaatgattgtggtgcgggacattgaactctactcattgtgcgaacaccacatgttg
ccattcattggcaaggcgcatgtcgcgtacctgccaacagggcgcgtgttagggctttcc
aaggttgcacgcgtagtggacatgttcgcccgtcgtttacagatacaggaaaacctgacg
cggcaaattgcgtatgccgtgcaggaagtcacggatgccgcaggggtggcggtcgtgatc
gaagccaagcatatgtgcatgatgatgcgcggtgtagagaagcagaactcggtgatgatt
tcatccgtgatgttaggtgcatttcgcgacgccccctcgacgcggcacgaattccttaac
ctcattggacgacacaactga

DBGET integrated database retrieval system