KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3367Help
Entry
PPUBIRD1_3367     CDS       T01975                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PPUBIRD1_3367
Enzymes [BR:ppb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PPUBIRD1_3367
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PPUBIRD1_3367
Lipid biosynthesis proteins [BR:ppb01004]
 Fatty acid synthase
  Component type
   PPUBIRD1_3367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3763996..3764601)
Genome map
AA seq 201 aa AA seqDB search
MRVWWLSAGLALYCLAQSAAAGTLLVVGDSISAGFGLDSRQGWVSLLQARLRDEGFDDKV
VNASISGDTSAGGQARLPALLAAHKPSLVVLELGGNDGLRGQPPAQLQQNLASMIEHSRQ
AGAKVLLLGMRLPPNYGVRYTTAFAKVYEQLAADKQVPLVPFFLEGVGGVPELMQADGIH
PAQGAQQRLLENAWPAIKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgtggtggttgagtgccggtctggccctgtattgcctggcccagagcgcagcg
gcaggaacactgctggttgttggcgatagtatcagcgccggttttggcctggatagccgt
cagggctgggtgtctctcttgcaggcccgcctcagggacgaaggttttgacgacaaagtg
gtcaatgcttcgatcagtggcgacaccagcgcaggtggccaggcgcggctgccggcgctg
cttgcagcacataaaccgagcctggtggtgctggaactgggcggcaacgatggcctgcgc
gggcagccgcctgcacaattgcaacaaaatcttgcctcgatgatcgagcattcgcgtcag
gcaggggccaaggtgttgctattgggcatgcgcctgccgcccaattatggtgtgcgttac
accactgcctttgccaaggtgtatgaacagctggcagcggacaaacaggttcctttggtg
ccgtttttcctcgaaggggtagggggagtgcctgaactgatgcaggctgatggcatccat
ccggcccaaggggctcagcagcgcctgctggaaaatgcctggccagcgataaaacccttg
ctgtga

DBGET integrated database retrieval system