KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3434Help
Entry
PPUBIRD1_3434     CDS       T01975                                 

Gene name
fadB_2
Definition
(GenBank) FadB_2
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00071  Fatty acid degradation
ppb00280  Valine, leucine and isoleucine degradation
ppb00281  Geraniol degradation
ppb00310  Lysine degradation
ppb00360  Phenylalanine metabolism
ppb00362  Benzoate degradation
ppb00380  Tryptophan metabolism
ppb00410  beta-Alanine metabolism
ppb00627  Aminobenzoate degradation
ppb00640  Propanoate metabolism
ppb00650  Butanoate metabolism
ppb00903  Limonene and pinene degradation
ppb00930  Caprolactam degradation
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01120  Microbial metabolism in diverse environments
ppb01130  Biosynthesis of antibiotics
ppb01212  Fatty acid metabolism
Module
ppb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PPUBIRD1_3434 (fadB_2)
   00650 Butanoate metabolism
    PPUBIRD1_3434 (fadB_2)
  Lipid metabolism
   00071 Fatty acid degradation
    PPUBIRD1_3434 (fadB_2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PPUBIRD1_3434 (fadB_2)
   00310 Lysine degradation
    PPUBIRD1_3434 (fadB_2)
   00360 Phenylalanine metabolism
    PPUBIRD1_3434 (fadB_2)
   00380 Tryptophan metabolism
    PPUBIRD1_3434 (fadB_2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PPUBIRD1_3434 (fadB_2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PPUBIRD1_3434 (fadB_2)
   00281 Geraniol degradation
    PPUBIRD1_3434 (fadB_2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PPUBIRD1_3434 (fadB_2)
   00627 Aminobenzoate degradation
    PPUBIRD1_3434 (fadB_2)
   00930 Caprolactam degradation
    PPUBIRD1_3434 (fadB_2)
Enzymes [BR:ppb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PPUBIRD1_3434 (fadB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ADR61029
Position
complement(3840690..3841463)
Genome map
AA seq 257 aa AA seqDB search
MAFETILLDIHGKVGLITLNRPQALNALNAQIVGEINQALDQLERDPNIGCVVLTGSAKA
FAAGADIKEMAELQYPQIYVDDLFSDADRIANRRKPIIAAVSGFALGGGCELAMMCDFIL
AADNAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMELCLTGRLMGAEEAERAGLVARIV
PQAELVEEALKVAAAIASKSIPVSMMVKESVNRAFEVTLSEGVRFERRVFHAAFATEDQK
EGMAAFIAKREAQFKDR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaaaccatcctgttggacatccacggcaaggttggcctgatcaccctcaac
cggccgcaggcgctcaatgcgctgaacgcgcagattgtcggcgaaatcaaccaggctctg
gaccagctcgagcgcgacccgaacatcggctgcgtggtgctgacaggctcggccaaagcc
tttgccgctggcgccgacatcaaggaaatggccgagctgcaatacccgcagatttacgtc
gacgacttgttcagcgacgccgaccgcattgccaatcgccgtaagccgatcattgctgcc
gtgtctggatttgccctgggcggcggctgtgagctggcgatgatgtgcgactttatcctc
gctgcggacaatgccaaatttggtcaaccggaaatcaacctgggcgttctgccgggcatg
ggcggcacccagcgcctgacgcgtgcggtgggcaaggccaaggccatggagctttgcctg
accggccgcctgatgggggcggaagaagccgagcgtgcaggtctggtggcgcggatcgtg
ccgcaagcagagctggtggaagaggcgctgaaggtggccgcggccattgccagcaagtcg
attccggtgagcatgatggtcaaggagagcgtcaaccgagcatttgaagtcaccctcagc
gagggggttcgctttgagcgtcgggtcttccatgcggctttcgccaccgaagaccagaaa
gaaggcatggccgcattcatcgccaagcgtgaggcacagttcaaggaccgttga

DBGET integrated database retrieval system