KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3455Help
Entry
PPUBIRD1_3455     CDS       T01975                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3866179..3867144)
Genome map
AA seq 321 aa AA seqDB search
MDQAASNDQAMTRDSLYGTAAESTYAGVVSFSRRRYSRDLRGVDVVVSGVPFDTATSNRP
GARFGPRAIRAASVQQAWARHWPWAFDPFDHLAVIDYGDCPFDSGTPQSVPDSIEAHAEH
ILQAGCAMLTLGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWPDEAGKRIDHGTMFWH
AAREGLVDPAHSVQIGLRTTNDDSQGFAILDARQVHRQGTEAVIAAIRQRVGERPVYLTF
DIDCLDPAYAPGTGTPVCGGLSTVQALEILGGLRGINLVGMDLVEVAPAYDHADITALAG
ATLAMEMLCLYAARHKVDNGQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtggaccaagccgcaagcaatgaccaggccatgacccgcgatagcctgtatggtaccgcc
gcagaaagcacctacgccggtgttgtcagtttttcccgccgtcgctacagccgcgacttg
cgcggtgtggatgtggtggtcagcggtgtgccgttcgacacggccaccagtaaccgcccc
ggcgcgcgcttcggcccgcgggcgatccgtgcggcctcggtccagcaggcctgggcccgc
cactggccgtgggcattcgacccgttcgaccacctggcggtgatcgactatggcgactgc
cccttcgacagcggcacgccgcagtcggtaccggacagcatcgaggcccatgccgagcac
attctgcaggcgggttgcgccatgctgacccttggtggcgaccatttcatcagctacccg
ctgctcaaggctcacgcccgccgccatggcccgctggcgctgatccatttcgatgcgcac
agtgacacctggccggacgaggcgggcaagcgcatcgaccacggcaccatgttctggcat
gccgcccgcgaaggcctggttgacccggcccactcggtgcagattggcctgcgcacgacc
aatgacgacagccagggctttgccattctcgatgccaggcaagtgcaccgccagggcaca
gaggcggtaattgcagcgattcgccagcgggtgggcgagcggccggtgtatctgaccttc
gacatcgactgcctcgacccggcctacgcgcccggtaccggaacgccagtgtgtggcggg
ctaagcacggtgcaggcgctggagattctgggtgggctgcgtggcatcaacctggtaggc
atggacttggtggaagtggcgccagcctatgaccatgccgatatcaccgcgttggccggg
gcaaccctggccatggagatgctgtgcctgtatgcggcgcggcacaaggtggataacggc
cagtag

DBGET integrated database retrieval system