KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3518Help
Entry
PPUBIRD1_3518     CDS       T01975                                 

Gene name
fadB_3
Definition
FadB_3 (EC:5.3.3.8 5.1.2.3 1.1.1.35 4.2.1.17)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPUBIRD1_3518 (fadB_3)
   01212 Fatty acid metabolism
    PPUBIRD1_3518 (fadB_3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PPUBIRD1_3518 (fadB_3)
   00650 Butanoate metabolism
    PPUBIRD1_3518 (fadB_3)
  Lipid metabolism
   00071 Fatty acid degradation
    PPUBIRD1_3518 (fadB_3)
   01040 Biosynthesis of unsaturated fatty acids
    PPUBIRD1_3518 (fadB_3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PPUBIRD1_3518 (fadB_3)
   00310 Lysine degradation
    PPUBIRD1_3518 (fadB_3)
   00380 Tryptophan metabolism
    PPUBIRD1_3518 (fadB_3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PPUBIRD1_3518 (fadB_3)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PPUBIRD1_3518 (fadB_3)
   00281 Geraniol degradation
    PPUBIRD1_3518 (fadB_3)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PPUBIRD1_3518 (fadB_3)
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PPUBIRD1_3518 (fadB_3)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PPUBIRD1_3518 (fadB_3)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PPUBIRD1_3518 (fadB_3)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     PPUBIRD1_3518 (fadB_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3933177..3935324)
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIRADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
MCLAADYRVMSTSARIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
KVGAVDAVVAPELLLAGALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKSIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQEL
KRKAKAHDEIAHDVKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEASKL
LGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEGQVK
DDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSDVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKRGKP
KKVFDATVLDVLKPIVFEQREVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgagctc
aagttcgacctcaagggtgagtccgtcaacaagttcaaccgccttaccctgaacgagctg
cgccaggccgtcgatgccatccgggccgatgcttcggtcaagggcgtgatcgtcagcagt
ggcaaggacgtgttcatcgtcggcgccgacatcaccgagttcgtcgacaacttcaagctg
cctgaggccgaactggtcgctggcaacctggaagccaatcgcatcttcaacgccttcgaa
gacctcgaagtgccgaccgtggctgccatcaacggcatcgcgctgggcggcggcctggaa
atgtgcctggcggccgactaccgggtcatgtccaccagcgccaggatcggcctgccggaa
gtcaagctgggtatctacccgggcttcggcggtaccgtgcgcctgccgcgcctgatcggc
tcggacaacgccatcgagtggatcgccgccggcaaggaaaaccgtgccgaagatgccctg
aaagtgggggccgtcgacgccgtggtcgcccctgagctgctgctggccggtgccctcgac
ctgatcaagcgtgccatcagtggcgagctggactacaaggccaagcgccagccgaagctg
gaaaagctcaagctcaatgccattgagcagatgatggccttcgagactgccaagggcttc
gtcgctggccaggccggcccgaactacccggccccggtcgaagcgatcaagagtatccag
aaagccgccaacttcggtcgcgacaaggccctggaagtcgaagctgcaggctttgccaag
ctggccaagacctcggtcgccgagagcctgatcggcttgttcctgaacgatcaggaactc
aagcgcaaggccaaggcgcatgacgagatcgcccacgacgtgaagcaggccgccgtgctc
ggcgccggcatcatgggcggcggtatcgcctaccagtcggcggtcaaaggtacgccgatc
ctgatgaaagacatccgcgaggaagccattcagctgggtctgaacgaggcctccaagctg
ctcggcaaccgcgtcgagaagggccgcctgaccccggccaagatggccgaggccctcaac
gccattcgcccgacgctgtcctatggcgatttcgccaatgtcgacatcgtcgtcgaggct
gtggtcgagaacccgaaggtcaagcaagcggtactggcggaagtggaaggccaggtgaag
gacgatgcgatcctcgcttccaacacctctaccatctcgatcaatctgctggccaaggcg
ctcaagcgcccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggttgaagtgatccgtggcgagaagtccagtgacgtggcggtcgccaccaccgtggcc
tacgccaagaagatgggcaagaacccgatcgtggtcaacgactgcccgggctttttggtc
aaccgcgtgctgttcccgtacttcggtggttttgccaagctggtcagcgccggtgtcgac
ttcgtgcgcatcgacaaggtcatggaaaagtttggctggccgatgggcccggcctacctg
atggacgtggtcggcatcgacaccggtcaccatggccgtgacgtcatggccgaaggcttc
ccggatcgcatgaaggacgagcgccgctcggcggtcgacgcgttgtacgaggccaaccgc
ctgggccagaagaacggtaagggcttctacgcctacgaaaccgacaagcgcggcaaaccg
aagaaggtcttcgatgccaccgtgctcgacgtgctcaaaccgatcgtgttcgagcagcgt
gaagtcactgacgaagacatcatcaactggatgatggtcccgctgtgcctggagaccgtg
cgttgcctggaagacggcattgtcgaaaccgccgccgaagctgacatgggcctggtctac
ggcattggtttccctcccttccgcggtggtgcgctgcgttacatcgactcgatcggtgtg
gccgaattcgtcgccctggccgatcagtatgccgacctggggccgctgtaccacccgacc
gccaagctgcgtgaaatggccaagaacggccagcgcttcttcaactga

DBGET integrated database retrieval system