KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3931Help
Entry
PPUBIRD1_3931     CDS       T01975                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00480  Glutathione metabolism
ppb00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PPUBIRD1_3931
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PPUBIRD1_3931
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PPUBIRD1_3931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ADR61516
Position
complement(4410203..4410754)
Genome map
AA seq 183 aa AA seqDB search
MRAHWLTVPVLALLASTSSWAADCPALLQGSLPELRGKGQVELCERFAGKPLVVVNTASY
CGFAPQFEGLEATYKEYHEQGLEMLGVPSNDFKQEDADSEKTAKVCYANYGVTFTMTKTQ
AVRGKDAIPLFAELASQSSAPKWNFYKYVVDRKGKVIGNFSSLTKPDDPAFRAAIEKAIA
SQQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcacattggttgacggtgccggtgctggccctgcttgccagtacatcgagctgg
gctgcagattgcccggcattgttgcagggcagcctgccggaattgcgcggcaaggggcag
gtcgagctgtgcgagcgctttgccggcaagccgctcgtggtggtgaacactgccagttat
tgcggttttgcccctcagttcgaggggctcgaggcgacgtacaaggagtatcacgagcaa
ggcctggaaatgctcggcgtgccgtccaatgacttcaagcaggaagacgctgacagtgag
aagactgccaaggtttgctatgccaactacggtgtcaccttcacgatgaccaagacgcag
gcggtgcggggcaaggatgcgataccgctgtttgcggaactggccagccagagcagtgcg
ccgaagtggaatttctacaagtatgttgtcgatcgcaagggcaaggtgatcggtaacttc
tccagcctgaccaaaccggatgatcccgcgttccgcgccgctatcgaaaaggccatcgcc
tcacagcagtaa

DBGET integrated database retrieval system