KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4018Help
Entry
PPUBIRD1_4018     CDS       T01975                                 

Gene name
dxr
Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ppb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4495759..4496949)
Genome map
AA seq 396 aa AA seqDB search
MSRPQRITVLGATGSIGLSTLDVIARHPDRYQAFALTGYSRVDELLALCVRHRPAFAVVP
STEAAVRLRASLAAAGCTTEVLEGEAGLCQVASAAEVDAVMAAIVGAAGLRPTLAAVEAG
KKVLLANKEALVMSGALFMEAVRQKGAVLLPIDSEHNAIFQCMPGDYARGLSAVGVRRIL
LTASGGPFRETPVEALLDVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAV
PSKVEVVVHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPERIDSGVAPLDLFAI
ARLDFQAPDEQRFPCLRLARQAAEAGNSAPAVLNAANEVAVQAFLERRIRFPEIAGMIEQ
VLDQEPVVPLPSLDAVFAADQRARELSREWLRRHGR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgcccgcagcgtattaccgtactcggggctaccggctccattggcctgagcacg
ctggatgtgattgcgcgtcatcctgaccgttatcaagcgttcgccctcactggctattcg
cgcgtcgacgagctgttggcgctatgcgtgcgtcatcgtccggcattcgctgtggtgccg
agcactgaggcggcggtgaggttgcgtgcgagtctggctgcggccggttgcaccaccgag
gtgctggaaggtgaggccgggctttgccaagtggcgtcggccgctgaagtggatgcagtg
atggcagccattgtcggtgctgccggcctgcgccccacgctggcggcagtcgaggcaggc
aagaaggtgttgctggccaacaaggaagcacttgtgatgtcgggcgcgctgttcatggag
gcggtgcggcaaaagggtgcggtgctgctgccgatcgacagtgaacacaacgctatcttc
cagtgcatgccaggcgactatgcccgtggcctgagtgccgtcggtgtgcgccggatcctg
cttaccgcgtccggcgggccgttccgcgaaacgccggtcgaggcgctgctggacgtgacc
ccggagcaagcctgtgcgcaccccaactggtccatggggcgcaagatctccgtggattcg
gccagcatgatgaacaaaggcctcgagttgatcgaagcctgctggttgttcgatgccgtg
ccgtccaaggttgaggtggtggtgcacccacagagcgtgatccactcgctggtcgactac
gtggacggttcggtactcgcgcagttgggcaacccggacatgcgtacgccgatcgccaac
gcgttggcctggccggaacggatcgattccggggttgcccctctggatctgttcgccatc
gcccgtctggatttccaggcgcccgacgaacaacgcttcccttgcctgcgccttgcgcgg
caggctgccgaggctggcaatagcgcgcctgccgtgctcaatgcggccaacgaagtcgcg
gtccaggcatttcttgaacggcgcatccgctttccggagatcgcgggtatgatcgaacag
gtactcgaccaggaaccggtcgtgccgctgccgtcgctggatgcggtgtttgccgccgat
cagcgtgcccgggagctttcccgtgagtggctgaggcgtcacggccgctga

DBGET integrated database retrieval system