KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4066Help
Entry
PPUBIRD1_4066     CDS       T01975                                 

Definition
Chemotaxis response regulator protein-glutamate methylesterase of group 3 operon (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PPUBIRD1_4066
Enzymes [BR:ppb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PPUBIRD1_4066
Two-component system [BR:ppb02022]
 CheA family
  WspE-WspRF
   PPUBIRD1_4066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4546937..4547950)
Genome map
AA seq 337 aa AA seqDB search
MKIAIVNDMPLAVEALRRAVALEPAHQVVWVASNGAEAVQRCTEQLPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDRKQNVHRVFEAMGHGALDVVDTPALGAGDAREAAAPLL
RKILNIGWLVGQQRAPAARSVAAPLREASQRRGLVAIGSSAGGPAALEVLLKGLPAAFPA
AIVLVQHVDQVFAAGMAEWLSSAAGLPVRLAREGEPPQPGQVLLAGTNHHIRLLQNGQLA
YTAEPVNEIYRPSIDVFFESVARYWNGDAVGVLLTGMGRDGAQGLKLMRQQGFLTIAQDQ
ASSAVYGMPKAAAAIDAAVEIRPLERIAGRLTEFFAK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccatcgtcaatgacatgcccctggccgtcgaagcgttgcgccgggcggtc
gccctggagcccgcacaccaggtcgtgtgggtggccagtaacggtgccgaggcggtgcag
cgctgcaccgagcagttaccggacctgatcctcatggacctgatcatgccggtgatggac
ggtgtcgaggcaacccggcggatcatggccgaaaccccgtgcgccattgttatcgtcacg
gtcgaccgtaagcagaacgtacaccgtgtattcgaggccatgggccatggcgccctcgat
gtggtcgacaccccggcgttgggcgctggcgatgcccgcgaagcggcggcgcccttgctg
cgcaagatcctcaatatcggctggctggtcggccagcagcgtgcacctgccgcaaggtcg
gtggctgcaccgctgcgcgaggcttcccagcgccgcgggttggtggcaatcgggtcttcg
gcgggtggcccggcagcactcgaagtgctgctcaagggtttgccggcagcgtttccggcg
gccatcgtgctggtccagcacgtggaccaggtgtttgccgcaggcatggccgaatggctc
agcagcgcagcaggcctgccggtgcgcctggcccgtgaaggcgaaccgccgcagccaggg
caggtactcctggccggtaccaaccaccacattcgcctgctacagaatggccaactggcc
tacactgccgaacctgtgaatgaaatttaccggccctcgatcgatgtgttcttcgagagc
gtggcacgttactggaatggtgatgcagtgggcgtgctgctcaccggcatgggccgcgac
ggtgcccagggcctgaagctgatgcgtcagcagggctttctgaccattgcccaggatcag
gccagcagcgcggtgtacggcatgcccaaggctgctgcggctattgatgccgccgtggaa
attcgcccgctggaacgcattgccgggcgcttgactgaatttttcgcaaaatga

DBGET integrated database retrieval system