KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4090Help
Entry
PPUBIRD1_4090     CDS       T01975                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppb  Pseudomonas putida BIRD-1
Brite
Enzymes [BR:ppb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PPUBIRD1_4090
Secretion system [BR:ppb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PPUBIRD1_4090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4572920..4573663)
Genome map
AA seq 247 aa AA seqDB search
MRVTQFFAAAALALASTFAVAAATDSNAGAEQAIRKSLQNLELEVPVESVASSPLNGLYE
VKLQGGRVLYASADGQFVMQGYLFQIQDGKPVNLTEKTERQGIAKLINGIPAAEMVVYPA
KGETKSHITVFTDTTCPYCHKLHAEVPELNRRGIEVRYVAFPRQGLGSAGDQQLQAVWCS
SDRRGAMDKMVEGEEIKAAKCTNPVSKQFQLGQSIGVNGTPAIVLESGQVIPGYQPAPQV
AKLALAK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccagtttttcgccgccgccgcgttggcgctggccagtacctttgccgtt
gctgcggcaaccgatagcaacgccggtgccgagcaggccatccgtaaatcgttgcagaac
ctcgagttggaagtgcccgtggaaagcgtggccagcagcccgcttaacggcctgtatgaa
gtcaagctgcagggcggccgcgtgctgtacgccagcgctgacggccagttcgtgatgcag
ggctacctgttccagatccaggacggcaagccggtcaacctcaccgaaaaaaccgaacgc
caaggcatcgccaagctcatcaacggcattccagccgccgagatggtggtttatcctgcc
aaaggcgagaccaagtcgcacatcaccgtgttcaccgacactacctgcccgtactgccac
aaactgcacgccgaagtgcctgagttgaaccgtcgcggtatcgaagtgcgctatgtcgcc
ttcccgcgccagggcctcggttcggcgggagaccagcagttgcaggcggtgtggtgctcc
agcgaccgccgtggggcgatggacaaaatggtcgaaggtgaagaaatcaaggccgccaag
tgcaccaacccggtcagcaagcagttccagctgggtcagtcgatcggtgtcaacggcacg
ccggccattgttcttgaaagcggccaggtcattccgggctaccagccggcaccgcaggtc
gccaagctggcacttgccaagtaa

DBGET integrated database retrieval system