KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4327Help
Entry
PPUBIRD1_4327     CDS       T01975                                 

Definition
short-chain dehydrogenase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPUBIRD1_4327
   00670 One carbon pool by folate
    PPUBIRD1_4327
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PPUBIRD1_4327
    1.5.1.-  
     PPUBIRD1_4327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4825745..4826482
Genome map
AA seq 245 aa AA seqDB search
MLGGNQRTDKLTTPNMNSPILVTGASQRVGLALALELAQAGHTVVSASRSIQPQAAHPNI
VQFQADLCQAGDRQALIDHLHDRYDGLRAIIHNASLWLDDGLDNLETMFRLHVEAPYHLN
LALGDLLAKVEKADIIHICDETSSRGSKSHIGYAATKAALQNMVLSFAEKYAPKVRVNGI
LPGLLILKEGGDDAYRQQTLKKALLEFEPGAGPLIETVKYLLASQYSTGSQVVINGGRHL
KNRMT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtggcaaccaaaggacagacaagttgaccaccccgaacatgaacagccccatt
ctcgttaccggagccagccagcgcgtcgggctggccctggccctcgaactggcacaggcc
ggccatacggtggtcagtgccagccgcagcatccagccgcaggcagcccaccccaacatc
gtgcagtttcaggccgacctgtgccaggcgggcgaccgccaggcgctgatcgatcacctg
cacgatcgttacgacggactgcgcgccatcatccacaacgcctcgctatggctcgacgac
ggcctcgacaacctcgagaccatgttccgcctgcacgtcgaagcgccctaccacctcaac
ctggccctgggcgacctgctggccaaggtggaaaaggccgacatcatccacatctgcgac
gaaacctcctcgcgcggcagtaaaagccacatcggctacgccgccaccaaggccgcgctg
cagaacatggtgctgtcattcgccgaaaaatatgcgcccaaggtgcgtgtgaacggtatc
ctgcctgggctgctgatcctcaaggaagggggtgacgacgcctaccgccagcaaaccctg
aaaaaggccctgctggagttcgaacccggcgccggcccgctgatcgagaccgtcaagtac
ctgctcgccagccagtacagcaccggcagccaggtggtcatcaacggtggccgccacctg
aagaaccgcatgacttga

DBGET integrated database retrieval system