KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4327Help
Entry
PPUBIRD1_4327     CDS       T01975                                 

Definition
short-chain dehydrogenase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ppb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4825745..4826482
Genome map
AA seq 245 aa AA seqDB search
MLGGNQRTDKLTTPNMNSPILVTGASQRVGLALALELAQAGHTVVSASRSIQPQAAHPNI
VQFQADLCQAGDRQALIDHLHDRYDGLRAIIHNASLWLDDGLDNLETMFRLHVEAPYHLN
LALGDLLAKVEKADIIHICDETSSRGSKSHIGYAATKAALQNMVLSFAEKYAPKVRVNGI
LPGLLILKEGGDDAYRQQTLKKALLEFEPGAGPLIETVKYLLASQYSTGSQVVINGGRHL
KNRMT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtggcaaccaaaggacagacaagttgaccaccccgaacatgaacagccccatt
ctcgttaccggagccagccagcgcgtcgggctggccctggccctcgaactggcacaggcc
ggccatacggtggtcagtgccagccgcagcatccagccgcaggcagcccaccccaacatc
gtgcagtttcaggccgacctgtgccaggcgggcgaccgccaggcgctgatcgatcacctg
cacgatcgttacgacggactgcgcgccatcatccacaacgcctcgctatggctcgacgac
ggcctcgacaacctcgagaccatgttccgcctgcacgtcgaagcgccctaccacctcaac
ctggccctgggcgacctgctggccaaggtggaaaaggccgacatcatccacatctgcgac
gaaacctcctcgcgcggcagtaaaagccacatcggctacgccgccaccaaggccgcgctg
cagaacatggtgctgtcattcgccgaaaaatatgcgcccaaggtgcgtgtgaacggtatc
ctgcctgggctgctgatcctcaaggaagggggtgacgacgcctaccgccagcaaaccctg
aaaaaggccctgctggagttcgaacccggcgccggcccgctgatcgagaccgtcaagtac
ctgctcgccagccagtacagcaccggcagccaggtggtcatcaacggtggccgccacctg
aagaaccgcatgacttga

DBGET integrated database retrieval system