KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4417Help
Entry
PPUBIRD1_4417     CDS       T01975                                 

Gene name
tpiA
Definition
TpiA protein (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPUBIRD1_4417 (tpiA)
   01230 Biosynthesis of amino acids
    PPUBIRD1_4417 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPUBIRD1_4417 (tpiA)
   00051 Fructose and mannose metabolism
    PPUBIRD1_4417 (tpiA)
   00562 Inositol phosphate metabolism
    PPUBIRD1_4417 (tpiA)
Enzymes [BR:ppb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PPUBIRD1_4417 (tpiA)
Exosome [BR:ppb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PPUBIRD1_4417 (tpiA)
  Exosomal proteins of bladder cancer cells
   PPUBIRD1_4417 (tpiA)
  Exosomal proteins of melanoma cells
   PPUBIRD1_4417 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4933904..4934647)
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELTKGLSNLALPSEVEVAVFPPALFINQVIDGLAGKEITVGAQN
SAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKGLKPV
LCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFADAVIAYEPVWAIGTGLTATPQQAQ
DVHAAIRGQLAAEDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaaaatgcacggtacccgcgctagcgtcgctgagctgaccaaa
ggcttgagtaatctcgccttgccgagcgaagtggaagtcgccgtatttccaccggccttg
ttcatcaatcaggtgattgatggcctggcaggtaaagaaattactgtcggcgcacagaat
tctgctgtacaacccgaacagggtgcgctgaccggggaagttgctcccgagcagctggtt
gaagcaggttgcaagttggtgttgattggtcactcggagcgtcgccagattattggtgaa
accgacgaagtgctcaatcgcaagtttgcagcggcccaggccaaaggcttgaagccagtg
ctttgcataggggaaacccttgaagagcgcgaggctggcaaaacgctcgaagttgtcggg
cgtcaactaagcagtatcatcgaagcattcggtgttaaggcttttgccgatgcagtaatt
gcctatgagcctgtatgggccatcggtacaggccttacggccacgccacagcaggcccag
gatgtgcacgccgccatccgcggccagttggcggcagaagatgctgaagtggctgcgaag
gtgcagttgctatacggcggcagcgtgaaggcggccaatgcggccgaactgttcggcatg
ccggatatcgatgggggtctcattggtggggcttccctgaacgcagacgaattcggtgca
atttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system