KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4417Help
Entry
PPUBIRD1_4417     CDS       T01975                                 

Gene name
tpiA
Definition
TpiA protein (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ppb01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppb01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppb00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ppb00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ppb00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4933904..4934647)
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELTKGLSNLALPSEVEVAVFPPALFINQVIDGLAGKEITVGAQN
SAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKGLKPV
LCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFADAVIAYEPVWAIGTGLTATPQQAQ
DVHAAIRGQLAAEDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaaaatgcacggtacccgcgctagcgtcgctgagctgaccaaa
ggcttgagtaatctcgccttgccgagcgaagtggaagtcgccgtatttccaccggccttg
ttcatcaatcaggtgattgatggcctggcaggtaaagaaattactgtcggcgcacagaat
tctgctgtacaacccgaacagggtgcgctgaccggggaagttgctcccgagcagctggtt
gaagcaggttgcaagttggtgttgattggtcactcggagcgtcgccagattattggtgaa
accgacgaagtgctcaatcgcaagtttgcagcggcccaggccaaaggcttgaagccagtg
ctttgcataggggaaacccttgaagagcgcgaggctggcaaaacgctcgaagttgtcggg
cgtcaactaagcagtatcatcgaagcattcggtgttaaggcttttgccgatgcagtaatt
gcctatgagcctgtatgggccatcggtacaggccttacggccacgccacagcaggcccag
gatgtgcacgccgccatccgcggccagttggcggcagaagatgctgaagtggctgcgaag
gtgcagttgctatacggcggcagcgtgaaggcggccaatgcggccgaactgttcggcatg
ccggatatcgatgggggtctcattggtggggcttccctgaacgcagacgaattcggtgca
atttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system