KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_5082Help
Entry
PPUBIRD1_5082     CDS       T01975                                 

Definition
Phosphomannomutase/phosphoglucomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPUBIRD1_5082
   00030 Pentose phosphate pathway
    PPUBIRD1_5082
   00051 Fructose and mannose metabolism
    PPUBIRD1_5082
   00052 Galactose metabolism
    PPUBIRD1_5082
   00500 Starch and sucrose metabolism
    PPUBIRD1_5082
   00520 Amino sugar and nucleotide sugar metabolism
    PPUBIRD1_5082
  Nucleotide metabolism
   00230 Purine metabolism
    PPUBIRD1_5082
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PPUBIRD1_5082
Enzymes [BR:ppb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PPUBIRD1_5082
    5.4.2.8  phosphomannomutase
     PPUBIRD1_5082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5687218..5688618
Genome map
AA seq 466 aa AA seqDB search
MNDMAHLVPAALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEPQVSVGRDG
RLSGPMLVEQLIKGLVDSGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGF
KIVIAGDTLANEQIQALLTRLKTNDLTLAQGRVEKVDILGRYFQQIVGDVKLAKKLKVVV
DCGNGAAGVVAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADI
GLAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTPLIEQH
GGRALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEILSKTE
QSAENLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEANLTTIDGVRVDYANGW
GLVRASNTTPVLVLRFEADSDAELQRIKDVFRTQLLRVEPELQLPF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatggcccacctggtccccgccgcattgcccgacagcattttccgcgcttat
gacatacgcggcgtggtcggcaagacccttcacgccgaaaccgcctactggatcggccgc
gccatcggcgcgcaaagcctggcccagggcgaaccgcaggtttcggtagggcgcgatggc
cgcctgtcgggcccgatgctggtggaacagctgatcaaaggcctggtcgattcgggctgc
cacgtcagcgacgtcggcctggtgcctaccccggcgctgtattacgcagccaacgtgctg
gccggcaagtccggtgtgatgctgaccggcagccacaacccgtcggactacaacggcttc
aagatcgtcatcgccggcgacaccttggccaacgaacagatccaggccctgctgacccgc
ctgaaaaccaacgacctgaccctggcccaaggccgcgtggaaaaggtcgatatcctcggc
cgctacttccagcagatcgtcggcgacgtgaagctggcgaaaaaactcaaggtggtggtg
gactgcggcaacggcgccgctggcgtggttgcaccgcaactgatcgaagccctgggctgc
gaagtgatcccgctgttctgcgaggtcgacggcaacttccccaaccaccacccggacccg
ggcaagccggaaaacctcgaggacctgatcgccaaggtcaaggaaaccggtgccgatatc
ggcctggccttcgacggtgacggcgaccgcgtcggcgtagtgaccaacaccggcagcatc
gtctaccccgaccgcctgctgatgctgtttgcccaggacgtgctgtcgcgcaacccgggc
gccgagatcatcttcgacgtcaaatgcacccgccgcctgaccccattgatcgaacagcac
ggtggccgcgccttgatgtggaaaaccggccattcgctgatcaagaaaaagatgaagcag
accggttcgctgctggcaggcgagatgagcggtcacatcttcatcaaggaacgctggtac
ggttttgacgacggcatctatagcgccgcgcgcctgctggagatcctcagcaagaccgag
cagagcgccgaaaacctgtttgccgccttcccgaacgatatttccacgccggaaatcaat
attgatgtgaccgacgagggtaaattcagcatcattgatgcactgcaacgcgacgccgac
tggggcgaagccaacctgaccaccatcgacggtgtgcgggtcgactacgccaacggctgg
ggcctggtacgcgcctccaacaccaccccggtgctggtgctgcgtttcgaggccgacagc
gacgccgaattgcaacgtatcaaggatgttttccgcacccagttgctgcgggtagagcct
gagctgcaactgccgttctga

DBGET integrated database retrieval system