KEGG   Pseudopropionibacterium propionicum: HMPREF9154_0041Help
Entry
HMPREF9154_0041   CDS       T02180                                 

Definition
(GenBank) putative 6-phosphofructokinase isozyme 1
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9154_0041
   00030 Pentose phosphate pathway
    HMPREF9154_0041
   00051 Fructose and mannose metabolism
    HMPREF9154_0041
   00052 Galactose metabolism
    HMPREF9154_0041
  Energy metabolism
   00680 Methane metabolism
    HMPREF9154_0041
Enzymes [BR:ppc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF9154_0041
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     HMPREF9154_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(41889..43016)
Genome map
AA seq 375 aa AA seqDB search
MGNAKRIGVLTAGGDSPGLNAAIRGLGKAAIGRHGMELIGFRDGVRGLAENRCFQLGPEA
LSGILTIGGTILGTSRDKVHRMRMGGEVVDAIPIIKDVVEQADLDCLVMLGGGGTAKNAL
RLSEAGIPVVHLPKTIDRDVAHTDNTFGFSTALEIATDAIDRLHSTAHSHHRVILAEIMG
HKAGWLALGAGIAGGADVILIPEIPYSVDAIAETIRARQARGTNFSVIAVAEGANDTAAA
QAIAAAESLKKAAGTPQEKAAAKSHLARVLDDHREHTFRLARSLEDATGLETRVTILGYV
QRGGTPCAEDRLLGSRIGTAAADLIADGVSGVMVASKGDGTEPVDLKKVAGNLAQVPPDH
PWIQTARDVGTGLGD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcgaaacgcatcggtgttctgacggcgggcggcgactcccccggcctgaac
gcggccatccgcgggctgggaaaggcggccatcggcagacacggcatggaattgatcggt
ttccgcgacggcgtgcgcggcttggccgagaaccggtgcttccagctcggcccggaagcg
ctgtcgggaatcctcaccattggcggcaccatcctcggcaccagccgcgacaaggtgcac
cgcatgcgcatgggcggcgaggtcgtcgacgcaatccccatcatcaaggatgtcgtcgag
caggccgatctcgactgcctggtgatgctgggtggcggcggcaccgcgaagaacgcgctg
cgcctgtcggaggcgggcattccggtggttcacctgcccaaaaccatcgaccgcgacgtc
gcccacaccgacaacaccttcggtttctccacggccttggagatcgccaccgacgccatc
gaccggctccactccaccgcccacagccaccaccgggtgatcctggccgagatcatgggc
cacaaggcgggctggctggccctgggcgcgggcatcgcgggcggggcggacgtcatcctg
atccccgagatcccttactccgtcgacgccatcgccgagaccatccgggcccggcaggca
cgcggcaccaacttcagcgtgatcgcggtggccgagggagccaacgacaccgcggcggcg
caggccatcgccgccgccgaatcgctgaagaaggccgccggaaccccgcaggagaaggca
gccgcgaaatcgcacctggcccgggtcctcgacgaccaccgcgaacacaccttccggttg
gcccgttccctggaggacgcgacgggcctggagacccgcgtcaccatcctcggctacgtg
cagcgcggcgggacgccatgcgcggaggaccggctgctggggtcgcggatcggcaccgcc
gccgccgacctgatcgccgacggggtcagcggggtgatggtcgcgagcaagggcgacggc
accgaacccgtcgacctgaagaaggtcgcgggcaatctggcccaggtcccaccggaccat
ccgtggatccagaccgcccgtgacgtgggaacgggtctcggggactga

DBGET integrated database retrieval system