KEGG   Propionibacterium propionicum: HMPREF9154_0041Help
Entry
HMPREF9154_0041   CDS       T02180                                 

Definition
putative 6-phosphofructokinase isozyme 1
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppc  Propionibacterium propionicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9154_0041
   01230 Biosynthesis of amino acids
    HMPREF9154_0041
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9154_0041
   00030 Pentose phosphate pathway
    HMPREF9154_0041
   00051 Fructose and mannose metabolism
    HMPREF9154_0041
   00052 Galactose metabolism
    HMPREF9154_0041
  Energy metabolism
   00680 Methane metabolism
    HMPREF9154_0041
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HMPREF9154_0041
Enzymes [BR:ppc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF9154_0041
Protein phosphatases and associated proteins [BR:ppc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF9154_0041
Messenger RNA biogenesis [BR:ppc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HMPREF9154_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41889..43016)
Genome map
AA seq 375 aa AA seqDB search
MGNAKRIGVLTAGGDSPGLNAAIRGLGKAAIGRHGMELIGFRDGVRGLAENRCFQLGPEA
LSGILTIGGTILGTSRDKVHRMRMGGEVVDAIPIIKDVVEQADLDCLVMLGGGGTAKNAL
RLSEAGIPVVHLPKTIDRDVAHTDNTFGFSTALEIATDAIDRLHSTAHSHHRVILAEIMG
HKAGWLALGAGIAGGADVILIPEIPYSVDAIAETIRARQARGTNFSVIAVAEGANDTAAA
QAIAAAESLKKAAGTPQEKAAAKSHLARVLDDHREHTFRLARSLEDATGLETRVTILGYV
QRGGTPCAEDRLLGSRIGTAAADLIADGVSGVMVASKGDGTEPVDLKKVAGNLAQVPPDH
PWIQTARDVGTGLGD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcgaaacgcatcggtgttctgacggcgggcggcgactcccccggcctgaac
gcggccatccgcgggctgggaaaggcggccatcggcagacacggcatggaattgatcggt
ttccgcgacggcgtgcgcggcttggccgagaaccggtgcttccagctcggcccggaagcg
ctgtcgggaatcctcaccattggcggcaccatcctcggcaccagccgcgacaaggtgcac
cgcatgcgcatgggcggcgaggtcgtcgacgcaatccccatcatcaaggatgtcgtcgag
caggccgatctcgactgcctggtgatgctgggtggcggcggcaccgcgaagaacgcgctg
cgcctgtcggaggcgggcattccggtggttcacctgcccaaaaccatcgaccgcgacgtc
gcccacaccgacaacaccttcggtttctccacggccttggagatcgccaccgacgccatc
gaccggctccactccaccgcccacagccaccaccgggtgatcctggccgagatcatgggc
cacaaggcgggctggctggccctgggcgcgggcatcgcgggcggggcggacgtcatcctg
atccccgagatcccttactccgtcgacgccatcgccgagaccatccgggcccggcaggca
cgcggcaccaacttcagcgtgatcgcggtggccgagggagccaacgacaccgcggcggcg
caggccatcgccgccgccgaatcgctgaagaaggccgccggaaccccgcaggagaaggca
gccgcgaaatcgcacctggcccgggtcctcgacgaccaccgcgaacacaccttccggttg
gcccgttccctggaggacgcgacgggcctggagacccgcgtcaccatcctcggctacgtg
cagcgcggcgggacgccatgcgcggaggaccggctgctggggtcgcggatcggcaccgcc
gccgccgacctgatcgccgacggggtcagcggggtgatggtcgcgagcaagggcgacggc
accgaacccgtcgacctgaagaaggtcgcgggcaatctggcccaggtcccaccggaccat
ccgtggatccagaccgcccgtgacgtgggaacgggtctcggggactga

DBGET integrated database retrieval system