KEGG   Pseudopropionibacterium propionicum: HMPREF9154_0041Help
Entry
HMPREF9154_0041   CDS       T02180                                 

Definition
(GenBank) putative 6-phosphofructokinase isozyme 1
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00010  Glycolysis / Gluconeogenesis
ppc00030  Pentose phosphate pathway
ppc00051  Fructose and mannose metabolism
ppc00052  Galactose metabolism
ppc00680  Methane metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01120  Microbial metabolism in diverse environments
ppc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9154_0041
   00030 Pentose phosphate pathway
    HMPREF9154_0041
   00051 Fructose and mannose metabolism
    HMPREF9154_0041
   00052 Galactose metabolism
    HMPREF9154_0041
  Energy metabolism
   00680 Methane metabolism
    HMPREF9154_0041
Enzymes [BR:ppc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF9154_0041
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     HMPREF9154_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK CutC NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AFN46348
UniProt: I6XQE5
Position
complement(41889..43016)
Genome map
AA seq 375 aa AA seqDB search
MGNAKRIGVLTAGGDSPGLNAAIRGLGKAAIGRHGMELIGFRDGVRGLAENRCFQLGPEA
LSGILTIGGTILGTSRDKVHRMRMGGEVVDAIPIIKDVVEQADLDCLVMLGGGGTAKNAL
RLSEAGIPVVHLPKTIDRDVAHTDNTFGFSTALEIATDAIDRLHSTAHSHHRVILAEIMG
HKAGWLALGAGIAGGADVILIPEIPYSVDAIAETIRARQARGTNFSVIAVAEGANDTAAA
QAIAAAESLKKAAGTPQEKAAAKSHLARVLDDHREHTFRLARSLEDATGLETRVTILGYV
QRGGTPCAEDRLLGSRIGTAAADLIADGVSGVMVASKGDGTEPVDLKKVAGNLAQVPPDH
PWIQTARDVGTGLGD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcgaaacgcatcggtgttctgacggcgggcggcgactcccccggcctgaac
gcggccatccgcgggctgggaaaggcggccatcggcagacacggcatggaattgatcggt
ttccgcgacggcgtgcgcggcttggccgagaaccggtgcttccagctcggcccggaagcg
ctgtcgggaatcctcaccattggcggcaccatcctcggcaccagccgcgacaaggtgcac
cgcatgcgcatgggcggcgaggtcgtcgacgcaatccccatcatcaaggatgtcgtcgag
caggccgatctcgactgcctggtgatgctgggtggcggcggcaccgcgaagaacgcgctg
cgcctgtcggaggcgggcattccggtggttcacctgcccaaaaccatcgaccgcgacgtc
gcccacaccgacaacaccttcggtttctccacggccttggagatcgccaccgacgccatc
gaccggctccactccaccgcccacagccaccaccgggtgatcctggccgagatcatgggc
cacaaggcgggctggctggccctgggcgcgggcatcgcgggcggggcggacgtcatcctg
atccccgagatcccttactccgtcgacgccatcgccgagaccatccgggcccggcaggca
cgcggcaccaacttcagcgtgatcgcggtggccgagggagccaacgacaccgcggcggcg
caggccatcgccgccgccgaatcgctgaagaaggccgccggaaccccgcaggagaaggca
gccgcgaaatcgcacctggcccgggtcctcgacgaccaccgcgaacacaccttccggttg
gcccgttccctggaggacgcgacgggcctggagacccgcgtcaccatcctcggctacgtg
cagcgcggcgggacgccatgcgcggaggaccggctgctggggtcgcggatcggcaccgcc
gccgccgacctgatcgccgacggggtcagcggggtgatggtcgcgagcaagggcgacggc
accgaacccgtcgacctgaagaaggtcgcgggcaatctggcccaggtcccaccggaccat
ccgtggatccagaccgcccgtgacgtgggaacgggtctcggggactga

DBGET integrated database retrieval system