KEGG   Propionibacterium propionicum: HMPREF9154_0421Help
Entry
HMPREF9154_0421   CDS       T02180                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ppc  Propionibacterium propionicum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
444985..445551
Genome map
AA seq 188 aa AA seqDB search
MSHVDQPRIEEAVREILLAVGEDPDRDGLSETPGRVARAYRELFSGLAQDPAELLSTTFD
IDHEELVLVRDIELTSCCEHHLLPFFGVAHVGYIPGGGRVTGLSKLARLVDIYARRPQVQ
ERLTTQVADALVTHLGAQGVIVVIEAEHTCMTMRGVRKPGSRTITSAVRGQLRNAATRAE
AMSLIMAR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgagccacgtcgaccagccccggatcgaggaggcggtccgtgagattctccttgcggtc
ggcgaggacccggatcgcgacgggttgtccgaaaccccggggcgcgtggcccgcgcctac
cgggagttgttctccgggctggcgcaggaccccgccgagctgctgtcgaccaccttcgac
atcgaccacgaggagctcgtgctcgtccgtgacatcgagctgacgagctgctgcgagcac
cacctgctgcccttcttcggggtggcgcacgtcggctacatccccggcggtggacgggtg
acgggactgtcgaaactggcccggctggtcgacatctacgcccgccgcccgcaggtgcag
gaacgcctcaccacgcaggtcgccgacgcgctcgtcacccacctgggcgcgcagggcgtg
atcgtcgtgatcgaggccgaacacacgtgcatgacgatgcggggggtgcgcaaaccgggc
agcaggaccatcaccagtgccgtgcgagggcagctgcgcaacgccgccacccgcgccgag
gccatgagcctgatcatggcgaggtga

DBGET integrated database retrieval system