KEGG   Propionibacterium propionicum: HMPREF9154_0470Help
Entry
HMPREF9154_0470   CDS       T02180                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppc  Propionibacterium propionicum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF9154_0470
Enzymes [BR:ppc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF9154_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
494350..495210
Genome map
AA seq 286 aa AA seqDB search
MDVDVLVVGSVNEDVVVSVERLPDPGETLLASELATSCGGKGANQAVAAARGEVRVAMAG
AVGDDEAGRRQAEALEAAGVDIRWLRRLAGVPTGTAFIQVDARGENTIVVAQGANTRVAL
PAGDVEARVIVTQNEIPPAVQQAAGELAVRTGARLVVNAAPAPEGPPSWYGNADPLVVNE
HEAAQLAASNEAGAGLLHRLRERTGARSLVMTLGARGALVDDGTGVHAIPPVVVERVVDA
TGAGDTFVGVLAARLALDEGLVAAASAANRSAAEAVTWPGARPPAE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggatgtgctggtcgtggggtccgttaacgaggacgtcgtggtgtccgtggaa
cggctcccggatcccggggagacgctcctggcctccgagctcgcaacctcgtgcggcggc
aagggggccaaccaggccgtcgccgcggcccgcggcgaggtccgggtggcgatggccggt
gccgtcggcgacgacgaggcggggcgccggcaggccgaggccctcgaagcggcgggcgtg
gacatccggtggctgcggcggctggccggtgtccccaccggaacggcattcatccaggtc
gatgcgcggggggagaacaccatagtcgtcgcccagggggccaacacccgggtcgcgctc
ccggccggcgacgtcgaggcccgggtcatcgtgacacagaacgagataccaccggccgtc
cagcaggcggcgggcgaactcgccgtccgcaccggggcgcggctggtggtcaacgccgcc
ccagcgcccgaggggccgccatcctggtacgggaacgcggatcccctggtggtgaacgaa
cacgaggccgcgcagctggcggcatcgaacgaggccggtgccgggctgctccatcggctg
cgggaacgcaccggggcccggagcctcgtgatgaccctcggggcgcgcggggctctcgtc
gacgacgggaccggggtgcacgccatcccgccggtggtcgtggagcgggtggtggacgcc
accggagcgggggacactttcgtcggcgtcctggctgcccggttggcgctggatgaagga
ctggtggcggcggcctccgcggcgaacaggtccgctgcggaggccgtcacctggccgggg
gcccgcccgccggctgagtga

DBGET integrated database retrieval system