KEGG   Propionibacterium propionicum: HMPREF9154_0550Help
Entry
HMPREF9154_0550   CDS       T02180                                 

Gene name
trpB_1
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppc  Propionibacterium propionicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF9154_0550 (trpB_1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9154_0550 (trpB_1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF9154_0550 (trpB_1)
Enzymes [BR:ppc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF9154_0550 (trpB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(575745..576941)
Genome map
AA seq 398 aa AA seqDB search
MTSLIHADEAGFFGNHGGRFLPPQLEAPIAEVAAAYAQARQDPGFQAEYEALLADYVGRP
SPLFLAAGLTRHLGGAKIYLKREDLNHTGAHKINHCLGEGLLAKRMGKKKLIAETGAGQH
GVALATAAALLGLECEIHMGAVDVAKQHPNVVRMEMLGARVVSITSGGQTLKEAIDSAFS
VFAADYADTFFAIGSAVGPDPYPSMVRDFQSIIGREARRQVLEKEDRLPDALVAAVGGGS
NALGLFTAFLEDEPVKMFGVEPAGRNLEVPGQHAATITLGTPGTLHGMRTLLLQDEDGNP
AEVHSIASGLDYPGVGPQHAFLRDTGRVEYVTASDDETIAAFQLLCRTEGIIPALESSHA
LAHAIRLAPTMSPDKVIVVNLSGRGDKDVDYVAEYLAR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgctgatccacgctgacgaggccgggttcttcgggaaccacggcggtcgtttc
ctgcccccgcagctcgaagctcccatcgccgaggtggcagctgcctacgcgcaggcccgc
caagaccccggtttccaggccgaatacgaggcgctgctggccgattacgtcggccgcccg
tcgccgctgttcctggcggccgggctgaccaggcacctcggcggggcgaagatctacctc
aaacgcgaggacctcaaccacaccggtgcccacaagatcaaccactgcctgggcgagggg
ctgctggccaagcggatgggcaaaaagaaattgatcgcggaaaccggcgcggggcagcac
ggcgtggcgctggcgaccgcagccgccctgctcggcctggagtgcgagatccacatgggc
gccgtcgacgtggccaaacagcatcccaacgtggtgcggatggagatgctgggcgcgagg
gtggtgtcgatcacctcgggtgggcaaaccctcaaggaggccatcgactcggccttctcg
gtgttcgccgccgactacgccgacaccttcttcgccatcggttcggccgtcggcccggac
ccgtacccgtcgatggtgcgggacttccagtcgatcatcggccgcgaggcccgccgccag
gtgctggagaaggaggatcgcctgccggatgcactggtggccgccgtcggcggcggctcg
aacgcactgggattgttcaccgccttcctggaggacgaaccggtgaagatgttcggcgtc
gaacccgcgggccgcaacctcgaagtgcccggccagcacgccgcgacgatcaccctcggc
accccggggacgctgcacggcatgcgcacgctgctgctgcaggacgaggacggcaacccg
gcggaggtgcactccattgcctccgggctggattacccgggggtcggcccgcagcacgcc
ttcctgcgggatacgggtcgcgtcgaatacgtcaccgcctccgacgacgagaccatcgcc
gccttccagctgctgtgccgcaccgagggcatcatccccgccctggagtcgtcgcacgcc
ctggcgcacgccatccggttggcgccgacgatgagtcctgacaaggtgattgtcgtgaac
ctgtcgggtcgcggcgacaaggacgtcgactacgtcgccgagtatttggcgcggtaa

DBGET integrated database retrieval system