KEGG   Propionibacterium propionicum: HMPREF9154_0550Help
Entry
HMPREF9154_0550   CDS       T02180                                 

Gene name
trpB_1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppc  Propionibacterium propionicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ppc00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ppc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(575745..576941)
Genome map
AA seq 398 aa AA seqDB search
MTSLIHADEAGFFGNHGGRFLPPQLEAPIAEVAAAYAQARQDPGFQAEYEALLADYVGRP
SPLFLAAGLTRHLGGAKIYLKREDLNHTGAHKINHCLGEGLLAKRMGKKKLIAETGAGQH
GVALATAAALLGLECEIHMGAVDVAKQHPNVVRMEMLGARVVSITSGGQTLKEAIDSAFS
VFAADYADTFFAIGSAVGPDPYPSMVRDFQSIIGREARRQVLEKEDRLPDALVAAVGGGS
NALGLFTAFLEDEPVKMFGVEPAGRNLEVPGQHAATITLGTPGTLHGMRTLLLQDEDGNP
AEVHSIASGLDYPGVGPQHAFLRDTGRVEYVTASDDETIAAFQLLCRTEGIIPALESSHA
LAHAIRLAPTMSPDKVIVVNLSGRGDKDVDYVAEYLAR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgctgatccacgctgacgaggccgggttcttcgggaaccacggcggtcgtttc
ctgcccccgcagctcgaagctcccatcgccgaggtggcagctgcctacgcgcaggcccgc
caagaccccggtttccaggccgaatacgaggcgctgctggccgattacgtcggccgcccg
tcgccgctgttcctggcggccgggctgaccaggcacctcggcggggcgaagatctacctc
aaacgcgaggacctcaaccacaccggtgcccacaagatcaaccactgcctgggcgagggg
ctgctggccaagcggatgggcaaaaagaaattgatcgcggaaaccggcgcggggcagcac
ggcgtggcgctggcgaccgcagccgccctgctcggcctggagtgcgagatccacatgggc
gccgtcgacgtggccaaacagcatcccaacgtggtgcggatggagatgctgggcgcgagg
gtggtgtcgatcacctcgggtgggcaaaccctcaaggaggccatcgactcggccttctcg
gtgttcgccgccgactacgccgacaccttcttcgccatcggttcggccgtcggcccggac
ccgtacccgtcgatggtgcgggacttccagtcgatcatcggccgcgaggcccgccgccag
gtgctggagaaggaggatcgcctgccggatgcactggtggccgccgtcggcggcggctcg
aacgcactgggattgttcaccgccttcctggaggacgaaccggtgaagatgttcggcgtc
gaacccgcgggccgcaacctcgaagtgcccggccagcacgccgcgacgatcaccctcggc
accccggggacgctgcacggcatgcgcacgctgctgctgcaggacgaggacggcaacccg
gcggaggtgcactccattgcctccgggctggattacccgggggtcggcccgcagcacgcc
ttcctgcgggatacgggtcgcgtcgaatacgtcaccgcctccgacgacgagaccatcgcc
gccttccagctgctgtgccgcaccgagggcatcatccccgccctggagtcgtcgcacgcc
ctggcgcacgccatccggttggcgccgacgatgagtcctgacaaggtgattgtcgtgaac
ctgtcgggtcgcggcgacaaggacgtcgactacgtcgccgagtatttggcgcggtaa

DBGET integrated database retrieval system