KEGG   Pseudopropionibacterium propionicum: HMPREF9154_0558Help
Entry
HMPREF9154_0558   CDS       T02180                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00900  Terpenoid backbone biosynthesis
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF9154_0558 (ispE)
Enzymes [BR:ppc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HMPREF9154_0558 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFN45868
UniProt: I6XP53
Position
585628..586527
Genome map
AA seq 299 aa AA seqDB search
MKEVRVRVPAKVNLALNVGATDNEGYHALGTLFQAVSLFDDLVARPAEAGVFRVSFRGEG
ASGLPTDDTNLVVRAARLLAGTCGTGNLGAEIRVHKRIPVAGGMAGGSADAAATLVACNQ
LWGTSLDTGQLHAVAARLGADVPFLLHGGTAVGTGRGEKLRPVPVRGSFQWVLALSHHGL
STPAVFREFDRISPPQPTGIDSGLLEALADGDARRVGALLRNDLQRAAFNLQPELADVLA
MGGEAGATGALVSGSGPTIAFLAGTKAVADAISDRLVLSSRVRAVRRAHGPVPGARIVN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggaagtgcgggtgcgggtgccggccaaggtgaacctggcgctgaacgtcggagcc
accgacaacgagggctatcacgccctcggaaccctgttccaggcggtgtcgctgttcgac
gacctggtggcgcgacccgccgaggccggggtgttccgggtgagtttccggggcgagggc
gcctccggcctgcccaccgacgacaccaacctcgtggtccgcgcggcccggctgctggcc
gggacctgcgggacgggaaacctcggggcggagatccgggttcataaacgcatccccgtc
gcaggaggcatggccgggggatcggccgatgccgccgccaccctggtcgcctgcaatcag
ttgtgggggacgagcctggatacggggcagctccacgctgtcgcggcccggctcggtgcc
gacgtgcccttcctgctgcacggcggcaccgccgtcggcaccgggcggggggagaagctg
aggcccgtgccggtgcgcggcagcttccaatgggtgctggcactgagccatcatggtctg
tccaccccagcggtgttccgggagttcgaccgcatcagtccaccccagcccaccggaatc
gattccggtctgctggaggccctggccgatggtgatgctcgccgtgtgggtgcgctgctc
agaaacgacctgcagcgggcggccttcaacctccagcccgagctggccgacgtcctggca
atgggaggcgaggcgggtgcgaccggcgccctggtgagcggctccggccccaccattgcc
ttcctggccggcaccaaggccgttgccgatgcgatctccgaccggctggtgctgtcttcc
cgggtccgtgccgtgcgtcgcgcccacgggccggtgccgggcgcgcggatcgtgaactga

DBGET integrated database retrieval system