KEGG   Propionibacterium propionicum: HMPREF9154_0644Help
Entry
HMPREF9154_0644   CDS       T02180                                 

Definition
e3 binding domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppc  Propionibacterium propionicum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ppc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ppc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppc00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679208..680563
Genome map
AA seq 451 aa AA seqDB search
MATVIVMPALGNSVESCLIVSWLVKEGDTIAENGILCEVETDKASMEVPSTASGTVLKLL
WAEGDDVPVKQPLLVVGEPGEDPAPVLAEVGFGAAQEETPEQATVATAEPPEQAPTGASV
AGDERGSSPRARNLAAAEGIDIATVPAGTGPGGRVIARDVAAVAETTTRAAARAGAVAGE
GTGLGGRVSQADLTAPAAPAEETPTPAPAAVGGADPDFPGPSTSTPLKGIRKVISERMMH
SLASSAQLTYTATARAQGLLDMRKKLKNSDPALGLNKVTIGDLVGFAAVRTAAKHPTHNA
HLEDGVLTTFERVHLGFACDTPRGLLVPTVRNASQLSLGQFSAICKDLAAQAIEGTISPD
LLGGATFTVSNLGGFGIEHFTPLLNVPQTAILGVDAIFPRAYADEKGKVRVEQRIGLSLT
ADHRVIDGADAARFLQDLVAFLENIELAALS
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgtcatagtcatgccggccctcgggaacagcgtcgagtcctgtctcatcgtt
tcctggctggtcaaggagggcgacaccatcgccgagaacggcatcctctgcgaggtggag
accgacaaggcctccatggaggtgcccagcaccgcgtccgggaccgtgctgaagctgctg
tgggccgagggcgacgacgtccccgtcaaacagcccctcctcgtggtaggggaacccggc
gaggaccccgcccccgtgctcgctgaggtgggtttcggcgccgcgcaggaggagaccccc
gaacaggccaccgtcgcgaccgctgagcctccggagcaggcgcccaccggcgcttccgtg
gccggtgacgaacgcggctccagtccgcgcgcccgcaacctggccgccgccgagggtatt
gacatcgcgaccgttcccgcgggcaccggccctggaggtcgcgtgatagcccgcgacgtc
gccgccgtcgccgagaccaccaccagggcggcggcccgggccggagcggtcgcgggtgag
ggcaccgggctcggcggtcgcgtcagccaggccgacctcaccgcccccgctgcgccggca
gaggaaacccccacgccggccccagcggcggtcggaggagccgacccggacttccccgga
cccagcacaagcaccccgctgaagggcatccgcaaggtgatctccgagcggatgatgcac
tccctggccagctccgcgcagctcacctacaccgccaccgcacgggcccagggtctcctc
gacatgcgcaagaagctgaagaactccgatccggcgctcggcttgaacaaggtgaccatc
ggcgacctcgtcggattcgccgccgtcaggaccgccgccaaacaccccacccacaacgcc
cacctcgaggacggagtgctgaccaccttcgagcgagtccacctcggtttcgcctgcgac
accccgcgcggcctcctcgtcccgacggtgcgcaacgcctcgcagctcagcctcggccaa
ttctccgcgatctgcaaggacctcgccgcgcaggccatcgagggaaccatcagccccgac
ctgctgggcggggccaccttcaccgtctccaatctgggtggtttcggcatcgaacacttc
accccgctgctgaacgtgccccagaccgcgatcctcggcgtcgacgccatcttcccgcgc
gcctacgcggatgagaagggcaaggtccgcgtcgagcagcgcatcgggttgtcgctgacc
gccgaccaccgggtcatcgacggcgccgacgcggcccgtttcctgcaggacctcgtggcc
ttcctcgagaacatcgaactggccgccctgagctga

DBGET integrated database retrieval system