KEGG   Propionibacterium propionicum: HMPREF9154_0660Help
Entry
HMPREF9154_0660   CDS       T02180                                 

Definition
glycosyl hydrolase family 3, N-terminal domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppc  Propionibacterium propionicum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9154_0660
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    HMPREF9154_0660
Enzymes [BR:ppc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HMPREF9154_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(703331..704647)
Genome map
AA seq 438 aa AA seqDB search
MQLLKSSYRDPLPEASGSAGAFPGGATNRLRTSKPTGGDFGSLRRFAAAAACASVLTGCA
AGPAAPPTEPATAAGTPSTSTPETPPSPAPTPAAVRCRAKADSLTTEQQAGQLFMIGVST
SGLDSATRKAIASGSVGSVVLLGDNNAGAGQISGITSELGTMRSAGMPLLVAVDQEGGRV
QRLKGPGFSDIPNAVEQGSLADGQLRNRAQAWGGELAAAGIHYDLAPVADVVPRNKQSSN
APIGKLNRNFGNNVTAVSRSVVEFTQGMQDAGIVTSLKHFPGLGEVTVNTDHGVARDGDT
TADGESLEPFRKGIEAGADSVMISSAIFTRIDPDQEGVFSRKIVTDMLRGDLGFQGVAIS
DDLGEAAAVGNVKPGDRAVRFFAAGGDLLINADPSLMDEMLKATITWAAENPGNADRLAE
SAGRVLALKESAGLLNCG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcttgaaatcctcgtaccgcgacccgctccccgaggcctccggctccgcggga
gcgtttcccggcggggcgacgaaccggttgcgcacctcgaaaccgaccggaggagatttc
ggttcccttcgtaggttcgccgcggccgcggcctgcgcctcggtgctgaccggttgcgcg
gcgggcccagcagcacctcccaccgaaccggccacggcagcggggaccccgagcacgtcc
acgccggaaacgcccccctcccccgcacccacgcccgccgcggtgaggtgccgcgcgaaa
gcggattccctgaccaccgaacagcaggccgggcagttgttcatgatcggggtgagcacc
tccggtctggacagcgcgacccggaaggccatcgcgtcggggtccgtcggatccgttgtg
ctgctcggcgacaacaacgcgggcgccggccagatcagcgggatcacctccgagctggga
acgatgcgctccgccggaatgccgttgctggtcgccgtcgaccaggagggcggccgggtg
caacgcctcaagggaccgggattcagcgacatcccgaacgccgtcgagcagggatcgttg
gcggacgggcagctgcggaaccgagcgcaggcgtggggtggggaactggctgccgccgga
atccactacgacctcgcgccggtcgccgacgtggtgccgaggaacaagcagagcagcaac
gccccgatcgggaaactcaaccgcaacttcggcaataacgtcaccgcggtgagcagatcg
gtggtggagttcacccagggcatgcaggacgcagggatagtgacctctctgaagcacttt
cccgggctgggtgaggtgacggtcaacaccgaccacggggtggccagggacggcgacacc
accgccgacggcgaatccctggagccgttccgcaaaggcatcgaggccggggccgactcg
gtgatgatctcgtcggcgatcttcacccggatcgacccggaccaggagggagttttcagc
aggaagatcgtcaccgacatgctgcgcggcgacctcggtttccaaggagtggctatcagc
gacgacctgggcgaggcggccgccgtggggaatgtcaaacccggcgaccgggcggtccgg
ttcttcgcggcgggaggggatctgctcatcaacgccgacccgtcgctgatggacgagatg
ctgaaggccaccatcacctgggcggccgagaacccgggcaacgccgaccggctggccgaa
tccgccggccgggtgctggcgctgaaggagtcggcggggctactgaactgcggatga

DBGET integrated database retrieval system