KEGG   Propionibacterium propionicum: HMPREF9154_0802Help
Entry
HMPREF9154_0802   CDS       T02180                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ppc  Propionibacterium propionicum
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
853173..855218
Genome map
AA seq 681 aa AA seqDB search
MSKTHGRDITVDGGRFLINGEQRNLYGGAVHYWRLDRNKWDSILESVKSMGFNMISIYIP
WEIHEVSKGEFDFSGNKDIDAFLTLCESKGFAIVVRPGPQINSELTWFGYPKRILENERL
QARNAKGARTVLTQVPKPIPALNYAEDEFFDETALWYDAICEILARHAHPKGGIVAAQVD
NEMAYFFCINAYAADFSDASLRNYRAFLSSKYGSLEKINEAHGTTVATMAEVDAPRRFEA
TKASEIPRYADWIEYRENYLIDSMARLADMMRERGLDTIALFHNYPHPLGPGGAASGFTT
PFNIAKLEEKLDFVGFDIYSRKELYSHVKTVGSYVVGTSRYPYIPEFIAGVWPWYLHPGN
LYDEEFVTKAALAQGIKGFSRYMLVERDRWLDSPIRRDGRVREDHAEMFGAANRMQLDGR
FGDLRRDASVLLLANREYDRLEAASVLVSFPGDFLETPSGFSEYAGPLTISEHTLGFDKA
PQLEKSEWFGAFYTALNSGDHDFLLSDTSLDPKRWGAHKVVVLTTLDYLDATLQQSLVDY
AAAGGVVVMGPRAPRFDSLMQPCTILADAIAAGASGIVLVATKDEAAQAVHRACVDAAVP
AVVKNDPDLDVIVHVDNTDPARRVVFVVNPTSRTVQASVSLGHSLSSVQELWTGTEGHTD
NETIRASLAPYSIHIYDCRLS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagacccatgggcgcgacatcacggtggatgggggccgattcctcatcaacggt
gagcagcgcaatctgtatggcggcgccgtccactattggcggctcgaccggaacaaatgg
gactcgatcctggagtccgtcaagtcgatggggttcaacatgatctccatctacatcccg
tgggagatccacgaggtgtcgaagggcgaattcgacttctcggggaacaaggacatcgat
gcgttcctgaccctgtgcgagagcaaaggcttcgcgatcgtcgtccgccccggtccccag
atcaactccgaactgacctggttcggctaccccaaacgaatcctggagaatgaacggctg
caggcccgcaacgccaagggtgcgcggacggtgctcacccaggtgcccaaacctatcccg
gcgctcaactacgccgaggacgagtttttcgatgagacagcgctctggtacgacgccatc
tgcgagatcctggcacgtcacgcgcacccgaagggaggcatcgttgcagcgcaggtcgac
aacgagatggcctacttcttctgcatcaacgcctatgccgccgacttcagcgacgcgtca
ctgcgcaactaccgggcgttcctgtccagcaagtacggctcactggagaagatcaacgag
gctcacggaacaactgtggcgacgatggccgaggtggacgctccccgccgtttcgaggcc
accaaagcgtccgagattccccgctatgcggactggatcgagtaccgggagaactacctg
atcgattccatggcgcgtcttgcggacatgatgagggaacgcggccttgacaccattgcc
ctgttccacaactacccgcaccccctcggccctggcggcgcagcctcggggttcaccacg
ccgttcaacatcgccaagctggaggagaagctcgatttcgtcgggtttgacatctattcc
cgcaaggagctctattcccacgtcaagaccgtgggcagctatgtggtgggcaccagccgc
tacccgtacatcccggagttcatcgccggagtgtggccatggtatctgcatccgggaaac
ctctacgacgaggaattcgtcacgaaggctgccctggcccagggcatcaaaggcttcagc
cgctacatgctcgtggagcgggaccggtggctcgactcgccgatccgtcgcgatggccga
gtccgtgaggaccacgccgagatgtttggcgcggccaacaggatgcaactcgatgggcga
ttcggcgatctgcgccgggacgcatccgtgctgctgctggcaaaccgcgagtacgaccgc
ctggaggccgccagcgtcctggtgtccttccccggcgacttcctcgagaccccctcgggc
ttctccgaatacgccggcccgctgaccatcagcgagcatacgctcggcttcgacaaggcc
ccccagctggagaagtcggaatggttcggggctttctacacggcgctgaacagcggtgac
catgacttcttgctctcggacacctcgctcgatcccaagcgctggggcgcgcacaaggtg
gtcgtcctgaccaccctcgactacctggatgccacgctgcagcagtcgctcgtcgactac
gccgccgctggtggtgtggtcgttatgggtccgcgggctcctcgcttcgacagcctgatg
caaccctgcaccatcctggccgacgccatcgccgcgggtgccagcggtatcgtcctcgtc
gcgacgaaggacgaagccgcccaggctgtccaccgtgcctgtgtcgacgccgcggtcccc
gcggtggtgaagaacgacccggatctcgacgtgatcgtgcatgtcgacaacacagatccg
gctcggcgggtcgtgttcgttgtgaacccgaccagccggacggttcaagcgagtgtctcc
ctcgggcacagcctctcctcggtccaggagctctggaccggaaccgaaggccacaccgac
aacgagacgattagggcatccctggcgccctattccattcacatctacgactgccggctt
tcctga

DBGET integrated database retrieval system