KEGG   Propionibacterium propionicum: HMPREF9154_0969Help
Entry
HMPREF9154_0969   CDS       T02180                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppc  Propionibacterium propionicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9154_0969 (malQ)
Enzymes [BR:ppc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HMPREF9154_0969 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055044..1057167
Genome map
AA seq 707 aa AA seqDB search
MSHLTAELDELAERLGIAREFWDWKGNHTLISEATVIAVLRAMGVEADTPEERRDALARL
DEQHWRRVLPPCTVVEEGETVRIDVHVPAGSPVSLDVVLENGERRPATQVDNWTPDREVA
GQLRGEASFEVTDLPLGYHRVEATSSEGTASAALVVTPGFVGFPPGMRNDRVWGYAVQLY
SVTSKRSWGFGDLTDLADLVAWAGNEQQAGFVLVNPLHAAQVTSPIEPSPYLPSSRRFLS
PLYIRPETVPEYANLPQPMRRRIRKLRKSVRGNGKVIDRDTVWKGKREALWELFRAGRRP
ARQLSFGGFRRRGGSALRDFAVWSALSEIHGTDWRQWPEELRDPRSTAAEEFAAAQAERV
EFFEWLQWTAQQQLSAAQTAAEEAGMGIGVLADLAVGVGKTSAETWLMGDVYAPGITVGA
PPDQYNQGGQDWGQPPWNPLKLEELEYEPFRVMVRAALNRVGGLRIDHIIGLFRLWWVPD
GLGPSAGTYVRYNHEALIGILALEARRAQALVVGEDLGTVEPWVREYLSRRGLLGTAILW
WEYGTDGQVLPPEKWREYCMASVTTHDLPPTLGYLESGHVRLREQLGLLLEPVEQELAVA
ERERDMWVERLIAFGLLDEALAGDHVEVMLAMHRYLRLTNSKVLVASLADAAGEKRAQNQ
PGTMNEYPNWRVPLADSGGKSLKLEDLFTADLPRRVADVMNGDRQDS
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacacctgactgccgagttggacgaactcgccgaacgcttgggaatagcccgggag
ttctgggactggaaaggaaaccacaccctcatatcggaggccaccgtgattgcggtgctc
cgggccatgggcgtggaggccgataccccggaggagcgcagggatgcgctggcccggctc
gacgagcagcattggcggcgggtcctgccgccctgcaccgtcgtcgaagagggggaaacg
gtacggatcgacgtgcacgttccggccgggtcgccggtgtccctcgacgtggtgctggaa
aacggggagagacggcccgcgacacaggtcgacaattggaccccggatcgcgaggtggcc
gggcagctccgtggcgaggccagcttcgaggtgacggacctgccgctcggataccaccgc
gtggaagccacatccagtgagggaaccgcttccgccgccctggtggtcactccgggattc
gtgggttttccgcccgggatgcgcaacgatcgcgtctggggatacgccgtccagctctac
agcgtcacgtcgaaacggtcctgggggttcggggacctcaccgatctcgccgatctcgtc
gcatgggccgggaacgagcagcaggcgggtttcgtgctggtcaacccgttgcacgcggcc
caggtcacatcgccgatcgagccttcaccgtacctaccctccagcaggcgtttcctgagc
ccgttgtacatcaggcccgagacggttcccgaatacgccaaccttccccagccgatgcga
cgccggatccgcaaactgcggaagtccgtgcgtggcaatggcaaggttatcgaccgtgac
accgtatggaaggggaaacgggaagcgctgtgggagctgttccgggccggacgccgcccc
gcacgccagttgtccttcggtgggttccgtcgccgtggcggcagcgcgctgcgtgatttc
gcggtctggagcgcgctcagcgagatccacggcaccgactggcggcagtggcccgaggaa
ctgcgcgacccgcgttccaccgcggcggaggagttcgccgcggcacaggccgagcgggtg
gagttcttcgagtggcttcagtggaccgcgcagcagcagctgtcggcggcgcagaccgcc
gcggaggaggcgggcatgggcatcggtgtgcttgccgacctggccgtgggggtcggcaag
accagcgcggaaacctggctcatgggcgacgtatacgcccccgggatcaccgtcggggct
cctccggatcagtacaaccagggcggtcaggactggggacagcccccgtggaacccgttg
aaactggaggagctcgagtacgaaccgttccgcgtcatggtgcgggccgccctgaaccgt
gtgggcgggctcaggatcgaccacatcatcggtttgttccggctgtggtgggtgcccgat
gggctcgggcccagcgcgggcacctacgtgcgttacaaccacgaggcgctgatcgggatc
ctggcgctggaggcgcgtcgcgcccaggccttggtggtgggggaggacctcggcaccgtc
gaaccctgggtgcgcgaatacctgtcgcgccgcggcctgctgggcaccgcgatcctgtgg
tgggagtacggaaccgacgggcaggtgctgcccccggagaagtggcgcgagtactgcatg
gcctcggtcaccacccacgacctgccccccaccctcggatacctcgagagcggtcatgtc
aggcttcgggaacagctcgggttgctgctggaaccggtcgagcaggaacttgccgtcgcc
gaacgggaacgcgacatgtgggtggaacgactgatcgccttcgggctcctcgacgaggcc
ctggccggtgatcacgtcgaggtgatgctggccatgcaccgctacctgcggttgaccaac
tccaaggtgctggtggcctccctggccgacgctgcgggggagaaacgcgcccagaaccaa
ccgggaacgatgaacgagtaccccaactggcgggtgccgctcgccgattccggggggaaa
tccctgaaactggaggatctgttcaccgctgacctgccccgccgggtcgcggacgtcatg
aacggtgaccggcaggattcctga

DBGET integrated database retrieval system