KEGG   Propionibacterium propionicum: HMPREF9154_1069Help
Entry
HMPREF9154_1069   CDS       T02180                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppc  Propionibacterium propionicum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9154_1069 (tpiA)
   01230 Biosynthesis of amino acids
    HMPREF9154_1069 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9154_1069 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF9154_1069 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF9154_1069 (tpiA)
Enzymes [BR:ppc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF9154_1069 (tpiA)
Exosome [BR:ppc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF9154_1069 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF9154_1069 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF9154_1069 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1191989..1192762
Genome map
AA seq 257 aa AA seqDB search
MARKPIMAGNWKMNLNHVEATGLVQKLAWTLADKEYDGSSVDCVVIPPFTDLRTVQTLIE
GDRFPIQLGAQNVSEHDSGAYTGEVSAGMLSKLGVRYVVVGHSERREYHGETDALINAKA
LKVLAADMIPIICCGEGLDIRKEGRHVEYTLEQVRGCLKGIPAEQVASLVIAYEPVWAIG
TGEVATPEDAQEVCGAIREEIAKLHDRATADAVRIQYGGSVKASNVAEIMAQPDVDGALV
GGASLKAEEFAAIVLFS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaaccgatcatggccggcaactggaagatgaacctgaaccacgtcgaggcg
acggggctcgtccagaaactggcctggaccctggccgacaaggagtacgacggcagttcc
gtcgactgcgtggtgattcctccgttcaccgacctgcgcacggtgcagaccctgatcgaa
ggggaccggttcccgatccagctcggggcgcagaacgtctccgaacacgactcgggtgcc
tacacgggtgaggtcagcgccgggatgttgtcgaagctgggggttcgttacgtggtggtc
gggcactcggagcgccgcgaataccacggcgagaccgacgccctgatcaacgccaaggcc
ctgaaggtcctggccgcggacatgatccccatcatctgttgcggtgagggcctggacatc
cgcaaggaagggcgccacgtcgagtacaccctcgagcaggttcgtggctgcctgaagggc
atccccgccgagcaggtggcctctcttgtcatcgcctacgagccggtgtgggcgatcggc
acaggcgaggtcgccaccccggaggacgcccaggaggtctgcggcgcgatccgtgaggaa
atcgcaaaactgcacgaccgggccaccgcggatgcggtccggatccaatacgggggatcc
gtgaaggcctccaacgtggccgagatcatggcccagccggatgtcgacggcgccctcgtc
ggcggcgccagcctgaaggccgaggagttcgccgcaatcgtgctgttctcctga

DBGET integrated database retrieval system