KEGG   Pseudopropionibacterium propionicum: HMPREF9154_1069Help
Entry
HMPREF9154_1069   CDS       T02180                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00010  Glycolysis / Gluconeogenesis
ppc00051  Fructose and mannose metabolism
ppc00562  Inositol phosphate metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01120  Microbial metabolism in diverse environments
ppc01130  Biosynthesis of antibiotics
ppc01200  Carbon metabolism
ppc01230  Biosynthesis of amino acids
Module
ppc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9154_1069 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF9154_1069 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF9154_1069 (tpiA)
Enzymes [BR:ppc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF9154_1069 (tpiA)
Exosome [BR:ppc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF9154_1069 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF9154_1069 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF9154_1069 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFN47538
UniProt: I6XTE6
Position
1191989..1192762
Genome map
AA seq 257 aa AA seqDB search
MARKPIMAGNWKMNLNHVEATGLVQKLAWTLADKEYDGSSVDCVVIPPFTDLRTVQTLIE
GDRFPIQLGAQNVSEHDSGAYTGEVSAGMLSKLGVRYVVVGHSERREYHGETDALINAKA
LKVLAADMIPIICCGEGLDIRKEGRHVEYTLEQVRGCLKGIPAEQVASLVIAYEPVWAIG
TGEVATPEDAQEVCGAIREEIAKLHDRATADAVRIQYGGSVKASNVAEIMAQPDVDGALV
GGASLKAEEFAAIVLFS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaaccgatcatggccggcaactggaagatgaacctgaaccacgtcgaggcg
acggggctcgtccagaaactggcctggaccctggccgacaaggagtacgacggcagttcc
gtcgactgcgtggtgattcctccgttcaccgacctgcgcacggtgcagaccctgatcgaa
ggggaccggttcccgatccagctcggggcgcagaacgtctccgaacacgactcgggtgcc
tacacgggtgaggtcagcgccgggatgttgtcgaagctgggggttcgttacgtggtggtc
gggcactcggagcgccgcgaataccacggcgagaccgacgccctgatcaacgccaaggcc
ctgaaggtcctggccgcggacatgatccccatcatctgttgcggtgagggcctggacatc
cgcaaggaagggcgccacgtcgagtacaccctcgagcaggttcgtggctgcctgaagggc
atccccgccgagcaggtggcctctcttgtcatcgcctacgagccggtgtgggcgatcggc
acaggcgaggtcgccaccccggaggacgcccaggaggtctgcggcgcgatccgtgaggaa
atcgcaaaactgcacgaccgggccaccgcggatgcggtccggatccaatacgggggatcc
gtgaaggcctccaacgtggccgagatcatggcccagccggatgtcgacggcgccctcgtc
ggcggcgccagcctgaaggccgaggagttcgccgcaatcgtgctgttctcctga

DBGET integrated database retrieval system